Entry information : PpaGOX01 (Pp3c19_3840)
Entry ID 13907
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-14 (Christophe Dunand)
Peroxidase information: PpaGOX01 (Pp3c19_3840)
Name (synonym) PpaGOX01 (Pp3c19_3840)
Class Glycolate Oxidase    [Orthogroup: GOX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaGOX01
start..stop
S start..stop
PpaGOX02 711 0 1..368 1..368
PpaGOX03 694 0 1..368 1..368
MpGOX01 629 0 4..364 6..366
HaGOX09 620 0 5..360 2..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 764..909 146 N° 2 1048..1622 575 N° 3 1755..1960 206 N° 4 2099..2278 180
join(764..909,1048..1622,1755..1960,2099..2278)


exon

Literature and cross-references PpaGOX01 (Pp3c19_3840)
Cluster/Prediction ref. Genebank:   5932276
Protein sequence: PpaGOX01 (Pp3c19_3840)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   369
PWM (Da):   %s   40236.24  
PI (pH):   %s   9.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSIAEVTNVTEYEELARQKLPKMVYDYYASGAEDQWTLKENRSAFERIRFRPRILIDVTKVDLSTNVLGFNISMPIMVAPTAMQRMAHPEGELATARAVAKAGTIMTLSSWATSSVEEVASVGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNKFVLPSHLTLANFEGLDLGKMDKTADSGLASYVAGQIDRSLTWKDVKWLQTITSLPILVKGVITAETELAVQHGAAGIIVSNHGARQLDYVSATISALEEVVQAARGRLPVFLDGGVRRGTDVLKALALGASGVIGRPVVFGLATDGQKGVENVLQMLRSEFELAMALAGCTKVSDIKRCHIQTEAERIHSKL*

Retrieve as FASTA  
Remarks (chromo 19, 4 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGATTGCCGAGGTTACCAACGTGACCGAGTATGAGGAGCTCGCAAGGCAGAAGCTGCCGAAGATGGTCTATGACTACTATGCTTCGGGCGCTGAGGACCAGTGGACCTTGAAAGAG
AACCGCAGCGCCTTCGAGCGCATCAG
GTACTTCTCAATGCACTCACTTGGTCGCCCTGAATCCCCTCTCCAGATGTAACCAGCCCTCCAATCTAGCTCGAATTCCTCCAAAACCCTTCCC
GTCTCAATACGCTTTAACACTCATAAGTGTTAAGGCATGTGCAGATTCCGGCCACGCATTCTTATCGACGTGACCAAGGTGGATCTGAGCACCAATGTGTTGGGCTTCAACATCTCCATG
CCCATCATGGTCGCACCCACCGCCATGCAAAGGATGGCTCACCCAGAGGGAGAATTGGCCACCGCAAGGGCTGTTGCCAAGGCCGGGACGATCATGACGCTTTCGTCGTGGGCCACCAGC
AGTGTGGAGGAGGTTGCCTCCGTTGGACCAGGCATCCGCTTCTTCCAGCTCTACGTCTACAAGGACCGAAACGTCGTCGCCCAGCTGGTGCGTCGTGCCGAGCGAGCCGGCTTCAAGGCT
ATTGCTCTGACCGTCGACACACCTCGCCTTGGACGCCGTGAGGCCGACATCAAGAACAAATTCGTGTTGCCGAGCCACCTGACTCTCGCTAACTTTGAGGGCTTGGACCTGGGCAAGATG
GACAAGACTGCGGACTCAGGATTGGCTTCCTACGTCGCTGGTCAGATCGATAGGTCCTTGACCTGGAAGGATGTGAAGTGGCTGCAGACCATCACCAGCCTCCCGATTCTTGTGAAGGGA
GTCATTACCGCCGAAGACA
GTAAGTGCATTTCTCCACAATTTTCACAGTAATTCGCCATTGAAATTTCGAAACCTGCCCCATCCCGGCAAATTCTTTTTTCTCATGTCTGGGCCTGTAAC
TGAACCTTGAATGTTAATTCGATCTGTGCAGCGGAGCTTGCTGTCCAACACGGAGCTGCAGGTATCATTGTGTCTAACCACGGTGCTCGCCAGCTCGACTACGTCTCTGCTACCATCTCG
GCTCTTGAGGAGGTGGTGCAAGCAGCCCGGGGCAGGCTTCCCGTCTTCCTCGACGGAGGTGTCCGACGTGGTACCGATGTTCTCAAGGCTCTTGCTCTCGGAGCATCCGGTGTCTTC
GTC
AGTAGACCTAACCTCAAACTTTCATTCTAAAGCCTTTTACTGCAAGCAGAATTGGAATATTACGTTGCAAGTTTTCTATTCTTCCTGTGGGTTTTATTTTACCTGAATTAACTTTGGATA
TGTCGGTGTTTGCAGATCGGAAGGCCCGTAGTGTTCGGCTTGGCAACAGACGGCCAAAAGGGAGTGGAGAATGTGCTGCAGATGCTGAGAAGTGAGTTCGAGTTGGCCATGGCGCTAGCA
GGCTGCACCAAAGTGTCAGACATCAAGCGCTGCCACATCCAAACCGAGGCTGAGCGCATTCACTCCAAGCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGATTGCCGAGGTTACCAACGTGACCGAGTATGAGGAGCTCGCAAGGCAGAAGCTGCCGAAGATGGTCTATGACTACTATGCTTCGGGCGCTGAGGACCAGTGGACCTTGAAAGAG
AACCGCAGCGCCTTCGAGCGCATCAG
ATTCCGGCCACGCATTCTTATCGACGTGACCAAGGTGGATCTGAGCACCAATGTGTTGGGCTTCAACATCTCCATGCCCATCATGGTCGCACCC
ACCGCCATGCAAAGGATGGCTCACCCAGAGGGAGAATTGGCCACCGCAAGGGCTGTTGCCAAGGCCGGGACGATCATGACGCTTTCGTCGTGGGCCACCAGCAGTGTGGAGGAGGTTGCC
TCCGTTGGACCAGGCATCCGCTTCTTCCAGCTCTACGTCTACAAGGACCGAAACGTCGTCGCCCAGCTGGTGCGTCGTGCCGAGCGAGCCGGCTTCAAGGCTATTGCTCTGACCGTCGAC
ACACCTCGCCTTGGACGCCGTGAGGCCGACATCAAGAACAAATTCGTGTTGCCGAGCCACCTGACTCTCGCTAACTTTGAGGGCTTGGACCTGGGCAAGATGGACAAGACTGCGGACTCA
GGATTGGCTTCCTACGTCGCTGGTCAGATCGATAGGTCCTTGACCTGGAAGGATGTGAAGTGGCTGCAGACCATCACCAGCCTCCCGATTCTTGTGAAGGGAGTCATTACCGCCGAAGAC
A
CGGAGCTTGCTGTCCAACACGGAGCTGCAGGTATCATTGTGTCTAACCACGGTGCTCGCCAGCTCGACTACGTCTCTGCTACCATCTCGGCTCTTGAGGAGGTGGTGCAAGCAGCCCGG
GGCAGGCTTCCCGTCTTCCTCGACGGAGGTGTCCGACGTGGTACCGATGTTCTCAAGGCTCTTGCTCTCGGAGCATCCGGTGTCTTC
ATCGGAAGGCCCGTAGTGTTCGGCTTGGCAACA
GACGGCCAAAAGGGAGTGGAGAATGTGCTGCAGATGCTGAGAAGTGAGTTCGAGTTGGCCATGGCGCTAGCAGGCTGCACCAAAGTGTCAGACATCAAGCGCTGCCACATCCAAACCGAG
GCTGAGCGCATTCACTCCAAGCTTTGA

Retrieve as FASTA