Entry information : PpaCSD02 (Pp3c24_4100/ Cu/ZnSOD)
Entry ID 13915
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: PpaCSD02 (Pp3c24_4100/ Cu/ZnSOD)
Name (synonym) PpaCSD02 (Pp3c24_4100/ Cu/ZnSOD)
Class Cu/Zn SOD    [Orthogroup: CSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaCSD02
start..stop
S start..stop
PpaCSD01 270 3e-94 1..156 42..197
LeCSD01 225 4e-77 4..154 2..151
AtrCSD02 224 1e-76 4..154 26..175
ThasCSD01-1 221 7e-76 4..154 2..151
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 406957..407041 85 N° 2 406445..406546 102 N° 3 406231..406326 96 N° 4 405945..405976 32
N° 5 405720..405795 76 N° 6 405529..405582 54 N° 7 405336..405364 29  
complement(join(405336..405364,405529..405582,405720..405795,405945..405976,4062 31..406326,406445..406546,406957..407041))


exon

Literature and cross-references PpaCSD02 (Pp3c24_4100/ Cu/ZnSOD)
Cluster/Prediction ref. Genebank:   5918827
Protein sequence: PpaCSD02 (Pp3c24_4100/ Cu/ZnSOD)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   158
PWM (Da):   %s   15639.91  
PI (pH):   %s   6.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPLKAICVLAGPSDSVTGVISFVQDGAGPTIVEGTVKGLNPGKHGFHVHALGDTTNGCMSTGPHFNPKGLEHGAPEDEVRHAGDLGNVIAGEDGIAKVSLKDAHIPLGGPNSIIGRAVVVHADPDDLGKGGHELSKSTGNAGARIACGIIGFQASA*

Retrieve as FASTA  
Remarks (Chromo 24, 5 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCTGAAGGCTATCTGCGTGCTCGCTGGCCCCTCCGACAGCGTTACCGGCGTCATCTCCTTTGTACAAGACGGAGCTGGTATGTATGGCTGCCAGGGTTTCGGGTTAGCATTA
TGCCTCGCGAAAAGTGATACTTGTGGAACAGAGGGGGATTGACTTTTTAAATCTCTCACTTGATCTTGTTTGTAAAAGATGAGGTTTAGCTGCGATAGAAGTGGATGACTGTGATTAGCT
GTAGCATATGACATTAGTGTGTGACTAGTGAGAGTGTTTCTTTATTGAATTCCGAAGGTCCTCACTGACACACTGGTAATTGACAGGAATAGGATATTGGCGCGTATAGTTCAAATTATT
CCTTATACCTTTATCCCCATGATATGGATAGGTTAGAATTAGTACTTGACATAGATACGCTTGCGTTTGATGTGACTGTCTAAGAAGAGATTTCTAGCTCATCTTTACGTATCTTAGCTT
CTGATGTCTGGACAGGCCCGACGATTGTGGAGGGAACAGTGAAGGGGTTGAACCCTGGCAAACATGGATTTCATGTCCATGCACTAGGGGACACAACCAATGGCTGCATGTCTACTGGTA
CTACACTCATTGTGGCAATCTTGCTAGGGTATGATTACTTTATCGTTGGATGTCGGCAACTATGGTTATGCTCTTCCTGAATTTGCCTTTTAAGTTCTTTTCTCGGTTAAATCAGGTCCT
CATTTCAACCCCAAGGGTCTAGAGCATGGTGCCCCCGAGGATGAAGTTCGTCATGCGGGAGACTTGGGTAACGTCATCGCCGGCGAAGATG
GTACCCAAGTTTTACACCTTTGGCTGTAG
TGCTATGGTTAGGGACAAGCTGGCGTCGACTTGCCCGAGTTATAGTTTGCAGCTTCCTTGATGTAGCTGGTGTAATTATGAATTCTCTCTCCTTCATGCTCTTTAATTCGGTTCTGTTTA
GAGATTATCAACTCTTTTGCGTCTCTATACTGTCCATTTGTTCTTGAAAGCGGAGGACTGAACTTCACGTGTTGAACTCCATTTGGATTTCTGGGATGTTTGCAGGCATTGCCAAGGTTT
CCCTGAAAGATGCTCAT
GTACTACTTCCGCAACACTACACTTTTCTTTTTAATTGGCTATCATGATCAGCTTGTTAACCAGGGTTTAGCATTTTTGTTTCTTAAAGATTAAATGATTTCA
GTATGCATTGATTTCTATAATTTCACTCCGCAATTATTCTGTGTAGATTCCTTTGGGTGGTCCAAACTCAATTATCGGTCGCGCAGTGGTTGTTCATGCTGATCCTGATGACCTCGGAAA
AG
GTGAGTTGGAAGCAGGGTTAGGGTTTTTACCTCAGAGGCTCAATCTGAAAGCCTCTTTTCTATTGATTTACTGAGAGTATCATTTTAGCGTGTGGCGTTTGTACCGTTGCTCACTTGT
TTTGTTCAATGACTTGTAGGTGGACACGAGCTAAGCAAGTCTACTGGAAATGCCGGTGCCCGCATTGCGTGTGGTCTGTATTCAAAAACACTGATATTTTAGTGGCTTGTAGAACTCTGA
AATTTCACATTTGTAGTAGATTTGAGAACCACTTGGATAGGTTCATGCATCGTGTTGTCCTTCGTGGCAAACCCTGTAGATGATGTACTTCTAAAAATCTCTTTTGAATTATTGCAGGAA
TTATTGGATTTCAGGCTTCAGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCTGAAGGCTATCTGCGTGCTCGCTGGCCCCTCCGACAGCGTTACCGGCGTCATCTCCTTTGTACAAGACGGAGCTGGCCCGACGATTGTGGAGGGAACAGTGAAGGGGTTG
AACCCTGGCAAACATGGATTTCATGTCCATGCACTAGGGGACACAACCAATGGCTGCATGTCTACTG
GTCCTCATTTCAACCCCAAGGGTCTAGAGCATGGTGCCCCCGAGGATGAAGTT
CGTCATGCGGGAGACTTGGGTAACGTCATCGCCGGCGAAGATG
GCATTGCCAAGGTTTCCCTGAAAGATGCTCATATTCCTTTGGGTGGTCCAAACTCAATTATCGGTCGCGCAGTGGTT
GTTCATGCTGATCCTGATGACCTCGGAAAAG
GTGGACACGAGCTAAGCAAGTCTACTGGAAATGCCGGTGCCCGCATTGCGTGTGGAATTATTGGATTTCAGGCTTCAGCTTGA

Retrieve as FASTA