Entry information : PpaCSD01 (Pp3c20_17920/Cu/ZnSOD)
Entry ID 13916
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: PpaCSD01 (Pp3c20_17920/Cu/ZnSOD)
Name (synonym) PpaCSD01 (Pp3c20_17920/Cu/ZnSOD)
Class Cu/Zn SOD    [Orthogroup: CSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaCSD01
start..stop
S start..stop
PpaCSD02 270 4e-94 42..197 1..156
LeCSD01 229 4e-78 46..195 3..151
ThasCSD01-1 226 8e-77 46..195 3..151
HaCSD02 227 4e-76 16..195 50..231
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1773844..1774051 208 N° 2 1772480..1772581 102 N° 3 1772242..1772337 96 N° 4 1771982..1772013 32
N° 5 1771764..1771839 76 N° 6 1771525..1771578 54 N° 7 1771340..1771368 29  
complement(join(1771340..1771368,1771525..1771578,1771764..1771839,1771982..1772 013,1772242..1772337,1772480..1772581,1773844..1774051))


exon

Literature and cross-references PpaCSD01 (Pp3c20_17920/Cu/ZnSOD)
Cluster/Prediction ref. Genebank:   5924012 [Incorrect prediction]
Protein sequence: PpaCSD01 (Pp3c20_17920/Cu/ZnSOD)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   199
PWM (Da):   %s   20473.1  
PI (pH):   %s   6.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSQLYKAFINCSFLHAARCFSSILSSSHLTKLYCVCVFQVMAPTKAVCVLTSPSSNVSGVISFVDEGSGYTTVEGEIKGLNPGKHGFHVHALGDTTNGCMSTGPHFNPKGFEHGAPEDEVRHAGDLGNVIAGDDGVAKVSLKDFQIPLTGADSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRIACGIIGLQAST*

Retrieve as FASTA  
Remarks (Chromo 20, 6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTCGCAGCTTTACAAAGCCTTCATAAATTGCTCTTTTCTCCATGCTGCGCGGTGTTTCTCCTCCATTCTATCGTCGTCCCATCTCACCAAACTCTACTGTGTGTGTGTGTTCCAA
GTTATGGCTCCTACCAAAGCCGTTTGCGTGCTCACTAGTCCCTCCAGCAACGTCTCCGGAGTCATCTCTTTCGTGGACGAGGGCTCTG
GTATGGCTGCCCTCGTCTCGTCTCGTCTTTTC
CTGTCCTCTCGGATTCTCTTCCTCCCCATGTGATAGTTTATGGAGTTAAGCATAATTTAAAGCTGTTCACATTGAGTTTTGGAGTTGGGTTTTGGAAGGTTCTCCTGGCAGGCTCACGGA
TGATTAGTTGTTTAATCGTTGTCAGGTTTGGTATCGACTCAGAGCTGAAAGAGTCGTTTTTGCGCATCAGAAAGTGCATATTCTCAAAGTGTTCGTTTCGTTGGCTGTATGGAGCGTGTG
CTTGGTTGTGGGGTTTATCGTATGGAAAATGGCATGCGTTTTTAGGGTTTAGTCTCTGGAGTTTGCTTTCTTGTTTGAGGGTTTGATGGGTGCAGTGCGCGTCTATAGGTTTTGGTATTT
GGTCTCTCTGCTACATTTGGGATTTTCTTCAGGATTATTTTTGTTTCTAGCTTGGTTGGGGCATGGCAAGGTGTCTGGCTTAGGCTCTTGGCTCGATCACTGCATGTATGCCAGATCGTA
ATGCTTGACTGGACATAGTATGGTCTGAAGGTTTTTAAGAGTTTGTGCAGCGTCGAGAATGCCATTTGTTGCTTTTGGCAGATGTTACTGTGACGTAGTTCCTTGTTGTGCGTCGTCCTT
TAGCTTGATGTGTCGCGTAGTTGTGGGAAGTCTTTGATACGAGTCTGATACTACTTGTGATTGTCGTTTTTTTGTCTGGCGATTGATTCGTAACGTATGGCGCCTTGAGAAGCGATGCAA
ACATAAGGTGTTTAAATTTGGTGTTTATCAGGAGACAGTTGATAATCTTCGATGTGTAATTTATCTTAGACTGGATCGGGCGAATGACTTTGTTTTGTAGAGAAAATTTTTAATCCTTTT
CTTCGCTATCTGAAAAGGATCGTCCCCTAATCTACTTACTACGGATAGTCAGATGACAGTACGTCGTAAATGCTCATCCACTTAATCAGTCTCTTGTGAGGTCAAGGGTCAGCCCACTAT
TTTTGACCTCTAGAATATCGTTGACCTCACAACCTAACTGCTGCTACAAGGGTAGGATGTACTTGTTTTGTTTGTTTCTGACCGAGGCTTCATGCACCAGCGTCGTGCATTTCGTAGATC
TCCTGAGGTCTTTCTTTGTTGGCTAAAGCCAGTCTTTTTCTGAAGTTGCTTTGTTAGGGTTTTGCGCACTGTGCTTGTGAATACGCTGATCCGTAGTGGTCGTGACTCAGTTGCGATGAT
CTTGTAACTTAAACAGTAATGTCCTGACAGGATACACGACTGTGGAGGGAGAAATTAAGGGATTGAATCCTGGCAAACATGGATTCCACGTCCATGCGTTGGGGGATACAACCAATGGCT
GCATGTCAACTG
GTGCGTCATTTGACTCATTGCTCTTTGAGAATAGTGAATGCATATATACTTTTTGTATATATAACCTGGCTCTTCGTCATGCTTAGTCTTGTATTCGTTCGTGGTGAA
GAATTTGCTTTTAATTGACCTTATTTGAACGCAGGTCCTCATTTCAACCCAAAGGGTTTTGAGCATGGTGCTCCTGAAGATGAAGTTCGTCATGCAGGAGACCTGGGGAATGTTATTGCC
GGTGATGATG
GTAAGGCTGCTGCTTGAGATTTAGGTTTGAAAATTTCCTGCTTCAGATTTGATGTTCTTGATATCTTTCATGTGTACAAGCTTTAGTTACTTTTGGAATATGATTATTTC
TTTTCTATCGTTACATCTCAAGTGTCATGCGGTAATCACAGTTCTAGTCACTTCGTGATTGGAAGAGTTTGGATTTTGAGTTGCGGTTTTAATTTTGTTTCTTAAATGTATGTCTCAGGT
GTAGCTAAAGTCTCTTTGAAAGATTTCCAG
GTACTACTTCAGCAATCCCGCACCGTTTTGATCGGCTGCCATCCTTTCTCGGTTCTGATCTGTTAATTAGAGGATACTGTGTGCTTCTCT
ACGTGTCATTTGATCTCAACGCTTGAATTTCTGTGCAACCATTTCTGTGCAGATTCCTTTGACCGGTGCAGACTCAATCATTGGCCGTGCTGTTGTCGTTCACGCCGACCCTGATGATCT
CGGAAAAG
GTGGGTTGAACGTGTATGATGAGAAGATTTCAGTGTGGGAGTAGGATTTGATTCTAGTCAAACTTAGGCAGGCTGCAGATTTCTATCGATACTTGAAATCCCGCTGACAGAT
CTTGTGTATACTAAGACTTCAAGTTCCAAGACGTTCATTTGTATGGTCCTGTTTGATGTGTTGTGGCTTCCAGGTGGACACGAGTTGAGCAAGTCTACTGGAAACGCCGGTGGCCGAATT
GCTTGCG
GTGGGTGTTTGAACCTCTTCAAACGTTCTTTTGTACATTACAGGGGAATTCTACACTGATTATGTGCCAAGAGAAATATCGGCATCAAATTAAGATTCGGAAATGTTGATTGA
TCTTGATACAAGTTTTGATGATTGCAATTTTCTGTTGTTGCAGGAATAATCGGTCTTCAGGCCTCAACTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTCGCAGCTTTACAAAGCCTTCATAAATTGCTCTTTTCTCCATGCTGCGCGGTGTTTCTCCTCCATTCTATCGTCGTCCCATCTCACCAAACTCTACTGTGTGTGTGTGTTCCAA
GTTATGGCTCCTACCAAAGCCGTTTGCGTGCTCACTAGTCCCTCCAGCAACGTCTCCGGAGTCATCTCTTTCGTGGACGAGGGCTCTG
GATACACGACTGTGGAGGGAGAAATTAAGGGA
TTGAATCCTGGCAAACATGGATTCCACGTCCATGCGTTGGGGGATACAACCAATGGCTGCATGTCAACTG
GTCCTCATTTCAACCCAAAGGGTTTTGAGCATGGTGCTCCTGAAGATGAA
GTTCGTCATGCAGGAGACCTGGGGAATGTTATTGCCGGTGATGATG
GTGTAGCTAAAGTCTCTTTGAAAGATTTCCAGATTCCTTTGACCGGTGCAGACTCAATCATTGGCCGTGCTGTT
GTCGTTCACGCCGACCCTGATGATCTCGGAAAAG
GTGGACACGAGTTGAGCAAGTCTACTGGAAACGCCGGTGGCCGAATTGCTTGCGGAATAATCGGTCTTCAGGCCTCAACTTAA

Retrieve as FASTA