Entry information : PpaCSD03 (Pp3c9_25690)
Entry ID 13917
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: PpaCSD03 (Pp3c9_25690)
Name (synonym) PpaCSD03 (Pp3c9_25690)
Class Cu/Zn SOD    [Orthogroup: CSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaCSD03
start..stop
S start..stop
PpaCSD04 385 5e-139 1..206 1..204
AtCSD02 274 7e-95 1..206 1..216
HaCSD04 271 1e-93 46..206 65..225
MpCSD01 265 7e-92 51..205 1..156
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 782393..782627 235 N° 2 782939..783000 62 N° 3 783264..783303 40 N° 4 783596..783691 96
N° 5 783826..783933 108 N° 6 784090..784143 54 N° 7 784356..784381 26  
join(782393..782627,782939..783000,783264..783303,783596..783691,783826..783933, 784090..784143,784356..784381)


exon

Literature and cross-references PpaCSD03 (Pp3c9_25690)
Cluster/Prediction ref. Genebank:   5934170
Protein sequence: PpaCSD03 (Pp3c9_25690)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   207 (185)
PWM (Da):   %s   20899.58 (18780.5)  
PI (pH):   %s   6.34 (6.34) Peptide Signal:   %s   cut: 23 range:22-206
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATAMAMSTLSTSLVAPTVAASQSAFQGASVRINHMPALGIVKSRPLTIVAATKKAVAVLKGNASVEGVVTLLQEDDGPTKVNVKITGLTPGKHGFHLHEFGDTTNGCMSTGPHFNPEGKTHGAPEDDNRHAGDLGNVIAGNDGVVEVTLEDSQIPLSGPHSVVGRAFVIHEAEDDLGKGGHELSSTTGNAGGRLACGVVGLTPL*

Retrieve as FASTA  
Remarks (Chromo 9, 6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGACGGCGATGGCCATGTCCACGCTCTCTACATCTCTCGTCGCTCCCACTGTGGCCGCGTCACAGTCCGCCTTCCAGGGTGCATCTGTGCGTATCAACCACATGCCTGCTTTG
GGTATTGTCAAGAGCCGCCCCCTCACCATTGTGGCAGCTACCAAGAAAGCCGTGGCTGTGCTCAAGGGCAATGCCAGTGTTGAGGGCGTTGTAACTCTTCTCCAGGAGGATGATG
GTGAA
TATTTCGAATCTGTCTTGAGCCATTTAATCGTTAATTTTTTTTACCCTTTATGGCTTAGATAGCCACTGTTACATTTAATTCAAGAGTTTGCAATGTTAACAAAATTGTGTCTGATACAA
GGTGTAATCATCTACTATAGTCACAATGTAGCTGGTGCGTATGCAACCACAGGAAATTGAGTGAGAAAGGATCTCCAATCCTTTGATTGGCAGTATAGGTGAAATAGTGCTCCAGCAATG
GGCGATGTTTGATTTAACATTTCATCACACTTCCGTGAACACTAATAATCGGAATCGTTCATGCAGGTCCCACAAAGGTCAATGTAAAGATCACTGGCTTGACTCCCGGCAAGCATGGAT
TCCATCTC
GTACGTCTCCTTTCTCTGTAGGCTTGTTTGCACTGGGGTGTTTCCACTGTACCGCATGCTTCATAGAATCATTTCAGAGTGCACTCCTTGCGTTGGCGTAAATTTTTATAAT
TTCGGAGACCGGTTTCAGTAGAGTGGGCATAGTTTGACATGAACAAAATCTGTAGAGATGGTTGGCATAATCACTGTGCAATAGTTTTCCTTGCGAAGAGAGCGTCAGCTAGGCGGAATC
TGATGAGGTCTATGATTTTGTCTTGATGTAGCATGAGTTTGGTGACACAACCAATGGCTGCATGTCTACTGGTGAGTTTACAAATGCTATTCGTGTTCTGTACATCTTAATTGGAATATC
AGGACTCTTGATTTTGGTGGATATTGTTACTTCTAGTAGATTTTTTCGTTTAAAAATTCTTCGAATTCAAAATCTGCACTTTGTGCAAAATTGCTACCAAGTGTAAGAGTCCTCTTATTG
GAGAGTCATTAGTAGGAATCTTACGAATTTTCATACGTAAAAAAGAGAAATTAGTCTGACTCTAGTCGGAATCTGTTGCGTAGAGAAGTCCTCTACATCTGATTTCGGGGCATATCCTTG
CAGGTCCTCACTTTAACCCTGAGGGCAAGACTCACGGTGCCCCAGAAGACGATAATCGACATGCAGGAGACTTGGGCAACGTTATTGCTGGCAATGATGGTGAATTTCCAACTAAATTTG
ATTGTGGCATTAGCTGCTATAGACTCTGTTTGTTCTATTAAAACCTGAAGTGTGGATGTTGGTAGGTAAATCATCCACTGTCGTTGATTTCCTTACTTTTGGCCCGATTACAGGCGTCGT
GGAGGTCACACTTGAGGACTCCCAGATTCCTCTATCCGGTCCACACTCCGTAGTTGGAAGGGCGTTCGTCATCCACGAAGCTGAAGACGATCTTGGAAAGG
GTTAGTGGACATAAATCCA
GCACTGCACTGCACTTTTGCCAATCAATAATATTAAAACCCACATTGTATGCATCTTAGAAAGATAGCAAAACCCATTACATGCGGCATAAGTTTCAAGCCTTACAGTACAAAGGCTAAC
AAATGTGTACCTTACAGGTGGCCACGAGCTCAGCTCTACAACCGGCAACGCAGGAGGACGACTTGCTTGCGGTAACACTTCCATGACCTCTGACAGTCTTCACTACCTTTATCACAAGCT
AAATGTCATCTTTAGTTTTTAATTTTTTCTGAATCTTTTTTAGAGTTTAGGAATCTTGAGGTGGCGAAGTTGAGGGCAATAGGAAGGTGAGATAGCCAGAGTTTTCAATGTGCTCGACAC
CGATGAAAATATCTGAGCCTTTAATTCGTGATGATGTGTGCAGGTGTTGTGGGTCTAACACCTCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGACGGCGATGGCCATGTCCACGCTCTCTACATCTCTCGTCGCTCCCACTGTGGCCGCGTCACAGTCCGCCTTCCAGGGTGCATCTGTGCGTATCAACCACATGCCTGCTTTG
GGTATTGTCAAGAGCCGCCCCCTCACCATTGTGGCAGCTACCAAGAAAGCCGTGGCTGTGCTCAAGGGCAATGCCAGTGTTGAGGGCGTTGTAACTCTTCTCCAGGAGGATGATG
GTCCC
ACAAAGGTCAATGTAAAGATCACTGGCTTGACTCCCGGCAAGCATGGATTCCATCTC
CATGAGTTTGGTGACACAACCAATGGCTGCATGTCTACTGGTCCTCACTTTAACCCTGAGGGC
AAGACTCACGGTGCCCCAGAAGACGATAATCGACATGCAGGAGACTTGGGCAACGTTATTGCTGGCAATGATG
GCGTCGTGGAGGTCACACTTGAGGACTCCCAGATTCCTCTATCCGGT
CCACACTCCGTAGTTGGAAGGGCGTTCGTCATCCACGAAGCTGAAGACGATCTTGGAAAGG
GTGGCCACGAGCTCAGCTCTACAACCGGCAACGCAGGAGGACGACTTGCTTGCGGTGTT
GTGGGTCTAACACCTCTGTAA

Retrieve as FASTA