Entry information : PpaCSD04 (Pp3c9_24840/ Cu/ZnSOD)
Entry ID 13918
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: PpaCSD04 (Pp3c9_24840/ Cu/ZnSOD)
Name (synonym) PpaCSD04 (Pp3c9_24840/ Cu/ZnSOD)
Class Cu/Zn SOD    [Orthogroup: CSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaCSD04
start..stop
S start..stop
PpaCSD03 385 5e-139 1..204 1..206
LeCSD03 272 3e-94 25..204 33..217
HaCSD04 271 1e-93 22..204 37..225
AtCSD02 270 3e-93 1..204 1..216
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 286400..286628 229 N° 2 286088..286149 62 N° 3 285766..285805 40 N° 4 285378..285473 96
N° 5 285135..285242 108 N° 6 284923..284976 54 N° 7 284702..284727 26  
complement(join(284702..284727,284923..284976,285135..285242,285378..285473,2857 66..285805,286088..286149,286400..286628))


exon

Literature and cross-references PpaCSD04 (Pp3c9_24840/ Cu/ZnSOD)
Cluster/Prediction ref. Genebank:   5934138 [Incorrect prediction]
Protein sequence: PpaCSD04 (Pp3c9_24840/ Cu/ZnSOD)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   205
PWM (Da):   %s   20649.49  
PI (pH):   %s   6.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATTMSTLSTSLVAPTVAASQSAFQGASVRVNLMPAVGVVKSRPLTIVAATKKAVAVLKGNANVEGVVTLLQEDDGPTKVNVKITGLAPGKHGFHLHEFGDTTNGCMSTGPHFNPEGKTHGAPEDQNRHAGDLGNVIAGDDGVVEVTLEDSQIPLSGPNSVVGRAFVIHEAEDDLGKGGHELSSTTGNAGGRLACGVVGLTPL*

Retrieve as FASTA  
Remarks (Chromo 9, 6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGACCACCATGTCCACGCTTTCTACATCTCTCGTCGCTCCCACCGTGGCGGCGTCACAGTCCGCTTTCCAGGGTGCGTCTGTGCGTGTGAACCTCATGCCTGCTGTGGGTGTG
GTCAAGAGCCGCCCCCTCACTATTGTAGCAGCCACCAAGAAAGCCGTGGCTGTGCTCAAGGGCAACGCCAATGTTGAGGGCGTTGTAACTCTTCTCCAGGAGGATGATG
GTGAATAATTC
AAATAACCGCTTTCCCATTCAATCTAAGAGAGTGTAATGCTCCTTAAGTTGGTTTTGATACACGGTGTAATTATTTACTATAGTTATAATATAGCTGGTGTGAATACAGCCACAGGGAAT
TGATCTAGAAAGGACCGTCAATCCTTTGATTAGAAGCATAAGTGAAACAATGCCCCAGTAATGGGCGATAATTGATTCAATACGGCTGTTAACACTAATTTCTAGGATCTTCGACGCAGG
TCCCACAAAGGTCAATGTGAAGATCACTGGCTTGGCTCCCGGCAAGCATGGATTCCATCTT
GTACGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCAATTTTTCTGTAGGATTGTAA
GCGCTGCAGTATTTTGATTGTACCGCATGCTTCATGGAATCAATTTAGAGTGCCCTTCTTGCATTGCAGTGTTATTTCATGATTTCGGAGGCTGTTTCCAGTTCAGTTGCATTGTTTGAC
ATGCACAGAAGTTATAGAGATTTCGTTTTACTATTGCTCTTCGCACGAAGAGGTCACCAGCCAATCAGAATCTGATGTGGGGTTTGATTTTGTATTGGTGTAGCATGAGTTCGGTGACAC
AACCAATGGCTGCATGTCTACTG
GTAAGTTTACAAATGTTATTTTTCTTTTGTACATCTCACTTAGAATCTCAAGACTCTTGAATTTGTGGTTGTTGATTCTTTTAGTAGGCTCTTCTGT
TTGAGAATACAAGGAATTTAAAACTTGCTCTTTGTGCGGAATTGCTTTCAAATTTGAGAGTCTTCTTACTGAAGAGTTGTCAGTCGGAACCTTTGAATTTGTTTATGCAAGAGAAAGTAA
GTAGTCTGTGTTAAGTCGCAATCTGTTACGTTGGGACAAGTCCTTCACATCTGACTTCGGGGGATACTCTTGCAGGTCCTCACTTTAACCCTGAGGGCAAGACTCACGGTGCCCCAGAAG
ACCAAAACCGTCATGCAGGAGACTTGGGCAATGTTATTGCTGGCGATGATG
GTGAATACCTAACTCATTTTGATTGTAGCGTTATCTGCTATAGACTCTGCTTTCACTATTAAAACCTGA
AGTATGGATATTGGTAGGTAATTCATTTACTGTCGTTGATTTCTTTCACGTTTGGTCCGATTACAGGTGTCGTCGAGGTCACGCTTGAGGATTCCCAGATTCCTCTATCCGGTCCGAACT
CCGTAGTTGGAAGGGCATTCGTTATTCACGAAGCTGAAGATGATCTCGGAAAGG
GTAAGCGGAGATAGAAGCAATCGTGCACTGAAATTTTGTTACTCATCTACCAGAGAGAACTCACGT
TATATACATCTTAGAAAGATAGCAAACCTCATAACATGCGTCATAACTTGTAAGGTCAGGAGGATGTAAGCTAATAAACTTTTACTTCACAGGTGGCCACGAGCTCAGCTCCACAACCGG
CAACGCAGGAGGCCGACTTGCTTGCG
GTATAACTTTCTTGACCTCCGAGAATCTTCAATTCATTTACCACAAACTGAAACACTTTTTATTATCTATGGAAATGAGTGAGTTTGAGGTGGG
CTATGTTCAGGGCTTCAGGAAGTAAAAATTCTCTAAGTTTACAATGTTCTTGACACCGGTGTACACATAACTGAGCCTGTAATCCATTGCGATGTGTGCAGGTGTTGTGGGTCTGACACC
CCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGACCACCATGTCCACGCTTTCTACATCTCTCGTCGCTCCCACCGTGGCGGCGTCACAGTCCGCTTTCCAGGGTGCGTCTGTGCGTGTGAACCTCATGCCTGCTGTGGGTGTG
GTCAAGAGCCGCCCCCTCACTATTGTAGCAGCCACCAAGAAAGCCGTGGCTGTGCTCAAGGGCAACGCCAATGTTGAGGGCGTTGTAACTCTTCTCCAGGAGGATGATG
GTCCCACAAAG
GTCAATGTGAAGATCACTGGCTTGGCTCCCGGCAAGCATGGATTCCATCTT
CATGAGTTCGGTGACACAACCAATGGCTGCATGTCTACTGGTCCTCACTTTAACCCTGAGGGCAAGACT
CACGGTGCCCCAGAAGACCAAAACCGTCATGCAGGAGACTTGGGCAATGTTATTGCTGGCGATGATG
GTGTCGTCGAGGTCACGCTTGAGGATTCCCAGATTCCTCTATCCGGTCCGAAC
TCCGTAGTTGGAAGGGCATTCGTTATTCACGAAGCTGAAGATGATCTCGGAAAGG
GTGGCCACGAGCTCAGCTCCACAACCGGCAACGCAGGAGGCCGACTTGCTTGCGGTGTTGTGGGT
CTGACACCCCTGTAG

Retrieve as FASTA