Entry information : KflAOX01 (Kfl_000610110)
Entry ID 13920
Creation 2016-10-17 (Christophe Dunand)
Last sequence changes 2016-10-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflAOX01 (Kfl_000610110)
Name (synonym) KflAOX01 (Kfl_000610110)
Class Alternative Oxidase    [Orthogroup: AOX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflAOX01
start..stop
S start..stop
ThasAOX04 362 4e-124 151..403 113..365
ThasAOX02 359 2e-123 151..403 84..336
HaAOX02 357 3e-123 136..403 46..312
HaAOX01 358 5e-123 156..403 88..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 66198..66507 310 N° 2 65663..65886 224 N° 3 65132..65260 129 N° 4 64704..64760 57
N° 5 64108..64379 272 N° 6 :63597..63756 63757 N° 7 63207..63266 60  
complement(join(63207..63266,:63597..63756,64108..64379,64704..64760,65132..6526 0,65663..65886,66198..66507))


exon

Literature and cross-references KflAOX01 (Kfl_000610110)
DNA ref. GenBank:   DF237010.1 (66507..63207)
Protein sequence: KflAOX01 (Kfl_000610110)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   403
PWM (Da):   %s   44441.58  
PI (pH):   %s   8.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVVHAALAKSVTQLSGGLLANSHCAIPNSPLFIIAARQFASWSASSAIPSHPLNLTTGTDSKSATGSSANVGSWSLQQGAITRDCSLPSTKFQAFDSFDNMSLGTRVYATSAKPPLQQGSAVVSPPTGAAYKHEGQPMNKSEAQVDKELAEGKYDYWGIRRKQLYKVDGTPWVWHSFPADSYQADTSVDLEKHWPVSGVADWVALKTVKFLRFWADTLFQKRWGCRAVMLETVAAVPGMVAGMLLHCKSLRRMEHSGGWIKALLEEAENERMHLMTFVEITKPRLWERALVFAVQGVFFNAYFVAYVLWPKVCHRIVGYLEEEAVISYTQWSSTLPSQRASRS*AVGCSPTATAPFPTPPSSSSQPGSLHHGLPAVPSRRIL*T*QQARIQRAPREAVPTWGLGACSRGPSPGTAVFPVPSSKPLIHLTTCLLVSGIGVAHQVFDVWCALLGYNQPDGPDAMINPARIDWLNLSYY*RASSSLDASGADMRSFKVVNHQ*AGVLMASFIQLQIGFLKSRDQKSNCFQ*PACSLLPSRHKGVCHFCQASLAARVCGGQPPHWSSIQA*GPANEQVRGAGG*GAGRGQV*LLGDSQEAAVQGRWHPLGVALFHGEWRCSGPL*ICHFKGFCLVVLALRVRFLSNLCT*YIDHDDI*R*RQDLDDHHVL*GLR*TLPVFRFVS*CDEEYSTGTLHSRERSFLKFLRNGWLGFAIILISILFPRSTRSSQPVMSGYQSD*RLRFGLSDAAGRLVPG*HQCGPREALARLWCCRLGGAQDGQVPEVLGRYAIPGEIGIAVSD*AE*IDPVMLHLCCHCWSMGLSTIQVCPIIVYRLSSVRRCY*KLLEFTEESCTHNQL*TQRKKSRRSCSESVRKLVRVYIFQMPHTIS*LVLLHAAGGVDHLRSTLTWLCFRFLQKRWGCRAVMLETVAAVPGMVSAKPLDSVLALEQVVGTCSRY*FSFRNTIH*PKVASSDIV*IRDSAFCKQIFSFDSTLTSFQ*PQAWLH*DEFLQYTVHTPCFPPRVFFV*LSTFQSPDVAPLLACQVAGMLLHCKSLRRMEHSGGWIKALLEEAENERMHLMTFVEITKPRLWERALVFAVQGVFFNAYFVAYVLWPKVCHRIVGYLEEEAVISYTQ*GLDRVLD*CLSFAVYLVERVYPFCTSCCPAASFTLRHCEVRHRRQ*PATPFEASQFPLDCALSSIPLSLNWRAVFPF*LHVDVFLPQPP*PARRGSGYGFKPHRRP*VGASSRVRSYLEAIDSGKIANTAAPAIAIDYWRLPKDAKLRDVVLAVRADEAHHRDVNHYAAVST*EAIKNCSNSVLLLDTDREKGECRTWT*NWHLSAILHGFGFR**RLADWPASLTCAVLRAR*RVPNCSSAIDGG*GLPGRLSACATCASSRNSRAANAYAPVASSLQNIKTEGKDLKESPAPIGYHNIKTEGKDLKESPAPIGYH*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGTCCACGCTGCCCTCGCAAAGAGCGTCACGCAGCTGAGCGGTGGGCTGCTCGCCAACAGCCACTGCGCCATTCCCAACTCCCCCCTCTTCATCATCGCAGCCAGGCAGTTTGCA
TCATGGTCTGCCAGCAGTGCCATCCCGTCGCATCCTCTGAACCTGACAACAGGCACGGATTCAAAGAGCGCCACGGGAAGCAGTGCCAACGTGGGGTCTTGGAGCCTGCAGCAGGGGGCC
ATCACCAGGGACTGCAGTCTTCCCAGTACCAAGTTCCAAGCCTTTGATTCATTTGACAACATGTCTCTTG
GTGAGTGGTATAGGAGTTGCCCATCAGGTGTTTGATGTCTGGTGTGCACT
TCTTGGATATAATCAGCCTGATGGTCCTGATGCAATGATCAATCCTGCACGGATTGATTGGTTGAACCTTTCGTACTACTGACGTGCTTCCAGTTCACTTGATGCGTCTGGTGCCGACAT
GAGATCTTTTAAGGTTGTCAACCATCAATAGGCAGGGGTTCTCATGGCAAGTTTCATTCAACTTCAGATTGGCTTTTTAAAATCAAGGGACCAGAAAAGCAACTGCTTCCAATGACCAGC
CTGCTCTCTCCTCCCCTCCAGGCACAAGGGTGTATGCCACTTCTGCCAAGCCTCCCTTGCAGCAAGGGTCTGCGGTGGTCAGCCCCCCCACTGGAGCAGCATACAAGCATGAGGGCCAGC
CAATGAACAAGTCAGAGGCGCAGGTGGATAAGGAGCTGGCCGAGGGCAAGTATGACTACTGGGGGATTCGCAGGAAGCAGCTGTACAAGGTCGATGGCACCCCCTGGGTGTGGCACTCTT
TCACG
GTGAGTGGCGCTGTTCTGGGCCTCTGTGAATTTGCCACTTCAAAGGTTTCTGCCTAGTGGTGCTTGCCTTAAGAGTTAGGTTCTTGTCTAATCTATGCACTTGATACATTGACCA
TGATGACATCTGACGGTGACGCCAGGATCTGGATGACCATCATGTGTTGTAGGGATTGAGATGAACATTGCCTGTGTTTCGATTCGTAAGTTGATGTGATGAAGAGTATAGCACGGGAAC
TCTTCATTCACGCGAACGTTCTTTCTTGAAGTTTCTTAGAAACGGTTGGTTGGGTTTTGCGATCATACTGATTTCAATCCTTTTCCCCCGGAGTACGCGATCTTCACAGCCCGTTATGTC
TGGGTATCAGTCTGACTGACGGCTCCGTTTTGGTTTATCTGATGCAGCCGGCAGACTCGTACCAGGCTGACACCAGTGTGGACCTCGAGAAGCACTGGCCCGTCTCTGGTGTTGCAGACT
GGGTGGCGCTCAAGACGGTCAAGTTCCTGAGGTTCTGGGCCGATACGCTATTCCAG
GTGAGATTGGAATTGCTGTTTCTGATTAGGCAGAATAGATTGATCCCGTTATGTTGCATTTATG
CTGTCACTGCTGGTCCATGGGTCTTTCCACAATTCAAGTATGTCCTATTATCGTCTATCGTCTGTCGTCTGTCAGGAGGTGCTACTAGAAGCTCCTGGAGTTCACCGAGGAATCATGTAC
CCACAATCAGTTGTAGACACAAAGGAAAAAATCTCGAAGAAGCTGCTCAGAGTCCGTGCGTAAACTTGTCAGAGTTTACATTTTCCAAATGCCCCACACAATTTCGTGATTGGTCTTGCT
TCATGCAGCTGGTGGTGTTGATCACTTGCGCAGCACTCTTACTTGGCTATGCTTCCGTTTTTTGCAGAAGCGGTGGGGCTGCCGTGCTGTCATGCTCGAGACTGTGGCTGCTGTCCCTGG
TATG
GTGAGTGCAAAGCCGCTTGACTCCGTCTTAGCACTTGAGCAGGTTGTGGGCACATGCTCCAGATACTGATTTTCCTTTAGAAACACTATCCATTAACCTAAAGTCGCTTCTTCTGA
CATCGTTTAGATACGAGATTCTGCTTTTTGTAAGCAAATCTTCTCATTCGACTCGACTTTAACAAGTTTTCAATGACCTCAGGCCTGGTTACACTAGGATGAGTTTCTCCAGTATACCGT
TCACACTCCCTGCTTTCCGCCTCGAGTATTTTTCGTGTAATTGTCGACTTTTCAGTCTCCTGACGTGGCTCCCCTCCTCGCCTGCCAGGTGGCGGGCATGCTGCTGCACTGCAAGTCGCT
GCGGCGCATGGAGCACAGCGGCGGCTGGATCAAGGCGCTGCTAGAAGAAGCCGAGAACGAGCGGATGCATCTGATGACGTTCGTGGAGATCACCAAGCCGCGGCTGTGGGAGCGCGCGCT
CGTGTTCGCGGTTCAGGGCGTCTTCTTCAACGCCTACTTTGTGGCGTACGTCCTGTGGCCCAAGGTCTGCCACCGCATCGTGGGATACCTGGAGGAGGAGGCCGTCATCTCTTACACGCA
GTAAGGACTCGACCGCGTGCTTGATTAGTGTCTAAGTTTTGCTGTTTATCTTGTTGAGCGTGTGTATCCGTTTTGTACATCCTGTTGTCCTGCCGCCTCCTTCACACTGAGACATTGTGA
GGTCCGTCATCGTCGCCAGTAACCTGCGACTCCGTTTGAGGCCTCCCAGTTTCCACTTGATTGTGCTCTCTCCTCTATTCCACTTTCCTTGAATTGGCGTGCCGTCTTTCCGTTTTGACT
CCATGTTGACGTCTTTCTTCCACAACCTCCTTAACCCGCAAGGCGGGGCTCTGGTTACGGCTTTAAACCCCATCGACGGCCATAAGTAGGAGCTTCCTCTCGCGTTCGCAGATGGTCGTC
CACGCTGCCCTCGCAAAGAGCGTCACGCAGCTGAGCGGTGGGCTGCTCGCCAACAGCCACTGCGCCATTCCCAACTCCCCCCTCTTCATCATCGCAGCCAGGCAGTTTGCATCATGGTCT
GCCAGCAGTGCCATCCCGTCGCATCCTCTGAACCTGACAACAGGCACGGATTCAAAGAGCGCCACGGGAAGCAGTGCCAACGTGGGGTCTTGGAGCCTGCAGCAGGGGGCCATCACCAGG
GACTGCAGTCTTCCCAGTACCAAGTTCCAAGCCTTTGATTCATTTGACAACATGTCTCTTGGTGAGTGGTATAGGAGTTGCCCATCAGGTGTTTGATGTCTGGTGTGCACTTCTTGGATA
TAATCAGCCTGATGGTCCTGATGCAATGATCAATCCTGCACGGATTGATTGGTTGAACCTTTCGTACTACTGACGTGCTTCCAGTTCACTTGATGCGTCTGGTGCCGACATGAGATCTTT
TAAGGTTGTCAACCATCAATAGGCAGGGGTTCTCATGGCAAGTTTCATTCAACTTCAGATTGGCTTTTTAAAATCAAGGGACCAGAAAAGCAACTGCTTCCAATGACCAGCCTGCTCTCT
CCTCCCCTCCAGGCACAAGGGTGTATGCCACTTCTGCCAAGCCTCCCTTGCAGCAAGGGTCTGCGGTGGTCAGCCCCCCCACTGGAGCAGCATACAAGCATGAGGGCCAGCCAATGAACA
AGTCAGAGGCGCAGGTGGATAAGGAGCTGGCCGAGGGCAAGTATGACTACTGGGGGATTCGCAGGAAGCAGCTGTACAAGGTCGATGGCACCCCCTGGGTGTGGCACTCTTTCACGGTGA
GTGGCGCTGTTCTGGGCCTCTGTGAATTTGCCACTTCAAAGGTTTCTGCCTAGTGGTGCTTGCCTTAAGAGTTAGGTTCTTGTCTAATCTATGCACTTGATACATTGACCATGATGACAT
CTGACGGTGACGCCAGGATCTGGATGACCATCATGTGTTGTAGGGATTGAGATGAACATTGCCTGTGTTTCGATTCGTAAGTTGATGTGATGAAGAGTATAGCACGGGAACTCTTCATTC
ACGCGAACGTTCTTTCTTGAAGTTTCTTAGAAACGGTTGGTTGGGTTTTGCGATCATACTGATTTCAATCCTTTTCCCCCGGAGTACGCGATCTTCACAGCCCGTTATGTCTGGGTATCA
GTCTGACTGACGGCTCCGTTTTGGTTTATCTGATGCAGCCGGCAGACTCGTACCAGGCTGACACCAGTGTGGACCTCGAGAAGCACTGGCCCGTCTCTGGTGTTGCAGACTGGGTGGCGC
TCAAGACGGTCAAGTTCCTGAGGTTCTGGGCCGATACGCTATTCCAGGTGAGATTGGAATTGCTGTTTCTGATTAGGCAGAATAGATTGATCCCGTTATGTTGCATTTATGCTGTCACTG
CTGGTCCATGGGTCTTTCCACAATTCAAGTATGTCCTATTATCGTCTATCGTCTGTCGTCTGTCAGGAGGTGCTACTAGAAGCTCCTGGAGTTCACCGAGGAATCATGTACCCACAATCA
GTTGTAGACACAAAGGAAAAAATCTCGAAGAAGCTGCTCAGAGTCCGTGCGTAAACTTGTCAGAGTTTACATTTTCCAAATGCCCCACACAATTTCGTGATTGGTCTTGCTTCATGCAGC
TGGTGGTGTTGATCACTTGCGCAGCACTCTTACTTGGCTATGCTTCCGTTTTTTGCAGAAGCGGTGGGGCTGCCGTGCTGTCATGCTCGAGACTGTGGCTGCTGTCCCTGGTATGGTGAG
TGCAAAGCCGCTTGACTCCGTCTTAGCACTTGAGCAGGTTGTGGGCACATGCTCCAGATACTGATTTTCCTTTAGAAACACTATCCATTAACCTAAAGTCGCTTCTTCTGACATCGTTTA
GATACGAGATTCTGCTTTTTGTAAGCAAATCTTCTCATTCGACTCGACTTTAACAAGTTTTCAATGACCTCAGGCCTGGTTACACTAGGATGAGTTTCTCCAGTATACCGTTCACACTCC
CTGCTTTCCGCCTCGAGTATTTTTCGTGTAATTGTCGACTTTTCAGTCTCCTGACGTGGCTCCCCTCCTCGCCTGCCAGGTGGCGGGCATGCTGCTGCACTGCAAGTCGCTGCGGCGCAT
GGAGCACAGCGGCGGCTGGATCAAGGCGCTGCTAGAAGAAGCCGAGAACGAGCGGATGCATCTGATGACGTTCGTGGAGATCACCAAGCCGCGGCTGTGGGAGCGCGCGCTCGTGTTCGC
GGTTCAGGGCGTCTTCTTCAACGCCTACTTTGTGGCGTACGTCCTGTGGCCCAAGGTCTGCCACCGCATCGTGGGATACCTGGAGGAGGAGGCCGTCATCTCTTACACGCAGTAAGGACT
CGACCGCGTGCTTGATTAGTGTCTAAGTTTTGCTGTTTATCTTGTTGAGCGTGTGTATCCGTTTTGTACATCCTGTTGTCCTGCCGCCTCCTTCACACTGAGACATTGTGAGGTCCGTCA
TCGTCGCCAGTAACCTGCGACTCCGTTTGAGGCCTCCCAGTTTCCACTTGATTGTGCTCTCTCCTCTATTCCACTTTCCTTGAATTGGCGTGCCGTCTTTCCGTTTTGACTCCATGTTGA
CGTCTTTCTTCCACAACCTCCTTAACCCGCAAGGCGGGGCTCTGGTTACGGCTTTAAACCCCATCGACGGCCATAAGTAGGAGCTTCCTCTCGCGTTCGCAGTTACTTGGAGGCCATTGA
CAGCGGCAAGATCGCCAACACGGCCGCCCCCGCGATTGCAATCGACTACTGGCGGCTGCCCAAGGATGCCAAGCTGCGCGACGTGGTCCTCGCGGTCAGGGCCGACGAGGCGCACCACCG
GGACGTCAACCACTACGCCGCGGTGAGCACATGAGAAGCGATTAAGAATTGCAGTAACTCTGTTCTCCTATTGGATACGGACAGAGAGAAAGGAGAATGTCGAACTTGGACGTAGAATTG
GCACTTGTCCGCCATTTTGCATGGTTTCGGATTTAGGTAGTGAAGATTGGCAGACTGGCCTGCTTCTCTCACGTGCGCTGTGCTTCGGGCCCGCTGAAGGGTTCCAAATTGTAGTTCCGC
GATTGATGGGGGTTGAGGTTTGCCTGGCCGCCTGTCTGCATGTGCTACTTGTGCTTCATCGAGGAACTCGAGGGCAGCAAATGCTTACGCGCCAGTTGCCTCGTCGCTGCAGAACATCAA
GACGGAAGGAAAGGATCTCAAGGAGTCCCCTGCACCAATTGGCTACCACTAG
AACATCAAGACGGAAGGAAAGGATCTCAAGGAGTCCCCTGCACCAATTGGCTACCACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGTCCACGCTGCCCTCGCAAAGAGCGTCACGCAGCTGAGCGGTGGGCTGCTCGCCAACAGCCACTGCGCCATTCCCAACTCCCCCCTCTTCATCATCGCAGCCAGGCAGTTTGCA
TCATGGTCTGCCAGCAGTGCCATCCCGTCGCATCCTCTGAACCTGACAACAGGCACGGATTCAAAGAGCGCCACGGGAAGCAGTGCCAACGTGGGGTCTTGGAGCCTGCAGCAGGGGGCC
ATCACCAGGGACTGCAGTCTTCCCAGTACCAAGTTCCAAGCCTTTGATTCATTTGACAACATGTCTCTTG
GCACAAGGGTGTATGCCACTTCTGCCAAGCCTCCCTTGCAGCAAGGGTCT
GCGGTGGTCAGCCCCCCCACTGGAGCAGCATACAAGCATGAGGGCCAGCCAATGAACAAGTCAGAGGCGCAGGTGGATAAGGAGCTGGCCGAGGGCAAGTATGACTACTGGGGGATTCGC
AGGAAGCAGCTGTACAAGGTCGATGGCACCCCCTGGGTGTGGCACTCTTTCACG
CCGGCAGACTCGTACCAGGCTGACACCAGTGTGGACCTCGAGAAGCACTGGCCCGTCTCTGGTGTT
GCAGACTGGGTGGCGCTCAAGACGGTCAAGTTCCTGAGGTTCTGGGCCGATACGCTATTCCAG
AAGCGGTGGGGCTGCCGTGCTGTCATGCTCGAGACTGTGGCTGCTGTCCCTGGTATG
GTGGCGGGCATGCTGCTGCACTGCAAGTCGCTGCGGCGCATGGAGCACAGCGGCGGCTGGATCAAGGCGCTGCTAGAAGAAGCCGAGAACGAGCGGATGCATCTGATGACGTTCGTGGAG
ATCACCAAGCCGCGGCTGTGGGAGCGCGCGCTCGTGTTCGCGGTTCAGGGCGTCTTCTTCAACGCCTACTTTGTGGCGTACGTCCTGTGGCCCAAGGTCTGCCACCGCATCGTGGGATAC
CTGGAGGAGGAGGCCGTCATCTCTTACACGCA
ATGGTCGTCCACGCTGCCCTCGCAAAGAGCGTCACGCAGCTGAGCGGTGGGCTGCTCGCCAACAGCCACTGCGCCATTCCCAACTCCC
CCCTCTTCATCATCGCAGCCAGGCAGTTTGCATCATGGTCTGCCAGCAGTGCCATCCCGTCGCATCCTCTGAACCTGACAACAGGCACGGATTCAAAGAGCGCCACGGGAAGCAGTGCCA
ACGTGGGGTCTTGGAGCCTGCAGCAGGGGGCCATCACCAGGGACTGCAGTCTTCCCAGTACCAAGTTCCAAGCCTTTGATTCATTTGACAACATGTCTCTTGGTGAGTGGTATAGGAGTT
GCCCATCAGGTGTTTGATGTCTGGTGTGCACTTCTTGGATATAATCAGCCTGATGGTCCTGATGCAATGATCAATCCTGCACGGATTGATTGGTTGAACCTTTCGTACTACTGACGTGCT
TCCAGTTCACTTGATGCGTCTGGTGCCGACATGAGATCTTTTAAGGTTGTCAACCATCAATAGGCAGGGGTTCTCATGGCAAGTTTCATTCAACTTCAGATTGGCTTTTTAAAATCAAGG
GACCAGAAAAGCAACTGCTTCCAATGACCAGCCTGCTCTCTCCTCCCCTCCAGGCACAAGGGTGTATGCCACTTCTGCCAAGCCTCCCTTGCAGCAAGGGTCTGCGGTGGTCAGCCCCCC
CACTGGAGCAGCATACAAGCATGAGGGCCAGCCAATGAACAAGTCAGAGGCGCAGGTGGATAAGGAGCTGGCCGAGGGCAAGTATGACTACTGGGGGATTCGCAGGAAGCAGCTGTACAA
GGTCGATGGCACCCCCTGGGTGTGGCACTCTTTCACGGTGAGTGGCGCTGTTCTGGGCCTCTGTGAATTTGCCACTTCAAAGGTTTCTGCCTAGTGGTGCTTGCCTTAAGAGTTAGGTTC
TTGTCTAATCTATGCACTTGATACATTGACCATGATGACATCTGACGGTGACGCCAGGATCTGGATGACCATCATGTGTTGTAGGGATTGAGATGAACATTGCCTGTGTTTCGATTCGTA
AGTTGATGTGATGAAGAGTATAGCACGGGAACTCTTCATTCACGCGAACGTTCTTTCTTGAAGTTTCTTAGAAACGGTTGGTTGGGTTTTGCGATCATACTGATTTCAATCCTTTTCCCC
CGGAGTACGCGATCTTCACAGCCCGTTATGTCTGGGTATCAGTCTGACTGACGGCTCCGTTTTGGTTTATCTGATGCAGCCGGCAGACTCGTACCAGGCTGACACCAGTGTGGACCTCGA
GAAGCACTGGCCCGTCTCTGGTGTTGCAGACTGGGTGGCGCTCAAGACGGTCAAGTTCCTGAGGTTCTGGGCCGATACGCTATTCCAGGTGAGATTGGAATTGCTGTTTCTGATTAGGCA
GAATAGATTGATCCCGTTATGTTGCATTTATGCTGTCACTGCTGGTCCATGGGTCTTTCCACAATTCAAGTATGTCCTATTATCGTCTATCGTCTGTCGTCTGTCAGGAGGTGCTACTAG
AAGCTCCTGGAGTTCACCGAGGAATCATGTACCCACAATCAGTTGTAGACACAAAGGAAAAAATCTCGAAGAAGCTGCTCAGAGTCCGTGCGTAAACTTGTCAGAGTTTACATTTTCCAA
ATGCCCCACACAATTTCGTGATTGGTCTTGCTTCATGCAGCTGGTGGTGTTGATCACTTGCGCAGCACTCTTACTTGGCTATGCTTCCGTTTTTTGCAGAAGCGGTGGGGCTGCCGTGCT
GTCATGCTCGAGACTGTGGCTGCTGTCCCTGGTATGGTGAGTGCAAAGCCGCTTGACTCCGTCTTAGCACTTGAGCAGGTTGTGGGCACATGCTCCAGATACTGATTTTCCTTTAGAAAC
ACTATCCATTAACCTAAAGTCGCTTCTTCTGACATCGTTTAGATACGAGATTCTGCTTTTTGTAAGCAAATCTTCTCATTCGACTCGACTTTAACAAGTTTTCAATGACCTCAGGCCTGG
TTACACTAGGATGAGTTTCTCCAGTATACCGTTCACACTCCCTGCTTTCCGCCTCGAGTATTTTTCGTGTAATTGTCGACTTTTCAGTCTCCTGACGTGGCTCCCCTCCTCGCCTGCCAG
GTGGCGGGCATGCTGCTGCACTGCAAGTCGCTGCGGCGCATGGAGCACAGCGGCGGCTGGATCAAGGCGCTGCTAGAAGAAGCCGAGAACGAGCGGATGCATCTGATGACGTTCGTGGAG
ATCACCAAGCCGCGGCTGTGGGAGCGCGCGCTCGTGTTCGCGGTTCAGGGCGTCTTCTTCAACGCCTACTTTGTGGCGTACGTCCTGTGGCCCAAGGTCTGCCACCGCATCGTGGGATAC
CTGGAGGAGGAGGCCGTCATCTCTTACACGCAGTAAGGACTCGACCGCGTGCTTGATTAGTGTCTAAGTTTTGCTGTTTATCTTGTTGAGCGTGTGTATCCGTTTTGTACATCCTGTTGT
CCTGCCGCCTCCTTCACACTGAGACATTGTGAGGTCCGTCATCGTCGCCAGTAACCTGCGACTCCGTTTGAGGCCTCCCAGTTTCCACTTGATTGTGCTCTCTCCTCTATTCCACTTTCC
TTGAATTGGCGTGCCGTCTTTCCGTTTTGACTCCATGTTGACGTCTTTCTTCCACAACCTCCTTAACCCGCAAGGCGGGGCTCTGGTTACGGCTTTAAACCCCATCGACGGCCATAAGTA
GGAGCTTCCTCTCGCGTTCGCAGTTACTTGGAGGCCATTGACAGCGGCAAGATCGCCAACACGGCCGCCCCCGCGATTGCAATCGACTACTGGCGGCTGCCCAAGGATGCCAAGCTGCGC
GACGTGGTCCTCGCGGTCAGGGCCGACGAGGCGCACCACCGGGACGTCAACCACTACGCCGCGGTGAGCACATGAGAAGCGATTAAGAATTGCAGTAACTCTGTTCTCCTATTGGATACG
GACAGAGAGAAAGGAGAATGTCGAACTTGGACGTAGAATTGGCACTTGTCCGCCATTTTGCATGGTTTCGGATTTAGGTAGTGAAGATTGGCAGACTGGCCTGCTTCTCTCACGTGCGCT
GTGCTTCGGGCCCGCTGAAGGGTTCCAAATTGTAGTTCCGCGATTGATGGGGGTTGAGGTTTGCCTGGCCGCCTGTCTGCATGTGCTACTTGTGCTTCATCGAGGAACTCGAGGGCAGCA
AATGCTTACGCGCCAGTTGCCTCGTCGCTGCAGAACATCAAGACGGAAGGAAAGGATCTCAAGGAGTCCCCTGCACCAATTGGCTACCACTAG
AACATCAAGACGGAAGGAAAGGATCTC
AAGGAGTCCCCTGCACCAATTGGCTACCACTAG

Retrieve as FASTA