Entry information : PpaMDAR03 (Pp3c2_8410)
Entry ID 13924
Creation 2016-10-18 (Christophe Dunand)
Last sequence changes 2016-10-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-18 (Christophe Dunand)
Peroxidase information: PpaMDAR03 (Pp3c2_8410)
Name (synonym) PpaMDAR03 (Pp3c2_8410)
Class Monodhydroascorbate Reductase    [Orthogroup: MDAR001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaMDAR03
start..stop
S start..stop
PpaMDAR02 658 0 1..434 22..455
PpaMDAR01 635 0 7..434 7..433
HaMDAR03 572 0 6..434 7..435
MpMDAR01 564 0 7..423 7..423
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 463174..463224 51 N° 2 462928..462999 72 N° 3 462684..462735 52 N° 4 462313..462393 81
N° 5 462060..462178 119 N° 6 461719..461938 220 N° 7 461332..461450 119 N° 8 460962..461087 126
N° 9 460687..460827 141 N° 10 460236..460559 324  
complement(join(460236..460559,460687..460827,460962..461087,461332..461450,4617 19..461938,462060..462178,462313..462393,462684..462735,462928..462999,463174..4 63224))


exon

Literature and cross-references PpaMDAR03 (Pp3c2_8410)
Cluster/Prediction ref. Gene atlas:   5941586 Phytozome Gene 11:   32933388
Protein sequence: PpaMDAR03 (Pp3c2_8410)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   435
PWM (Da):   %s   46482.69  
PI (pH):   %s   5.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDAAMLKYVLVGGGVAGGYAAREFVKLGVNPGELAIFSKEPVAPYERPALSKAYLFPESPARLPGFHTCVGSGGERQAPEWYADNGIDLHLSSEIAKADTKSKTITTAQGKTFEYGSLLIATGSFINLADFKTPGADAGGIHYLREKDDADKLVEEIGANKGGEAVVVGGGYIGVELAACLALNSIRVTMVFPDPHFMPRLFTPEIASFYESYYKAKGINIIKGTSVTAFEKDDQGNVVKVILGDGRSLSTNLVVVGIGARPNLGPFKGLLEEEKGGFVDSSFRSSAEDVYAVGDIATFPLKMYGDRRRVEHVDHARKSAIQAVQAIKAAEKGETVDDYDYLPFFYSRSFDLSWQFYGDNTGDSVVWGLDGASASGSKFGAYWINDGKVVGAFLEGGSPDENKLLARVARQRPSVSSKKDLISGGLDFAAKI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACGCAGCTATGCTGAAGTACGTGCTAGTAGGCGGAGGTGTTGCAGGGGTAAGAGATTCTTTTATTTTGCAGCTATGGTGATCTCTGCAGTGAAGAATGAGGTCCTCATTTTTGCTA
TTAATTTTCTTTTCTTTTCTTTTCTTTTCAAGCTTCGTTCCTAACCTTGAAACATATGGGGAAGTTCTGAAGTTAAAGTTGTATTTCTTTCATTAAAATTCGCAGGGATACGCAGCGCGG
GAATTTGTAAAGTTGGGTGTGAATCCTGGAGAGCTTGCAATTTTCTCCAAAGAACCG
GTACTAAATACATAGCGTATCTGTGCAGTTGCCATGCTGAAAATGGGTGCCCCACGTTGCTTA
GAACTGCTCTTCAAATTGCTCAAATGTATATGATAAGTCTGGTGATCTTCGACATTCTGTTACAATGTCTTGTCGTCTGTGAATAGTGAGTTGTTTGACCCTAACAACATGGTATTGATA
CCCCAACAGGTTGCGCCCTATGAACGGCCCGCCTTGAGCAAGGCATACTTGTTTCCTGAATGTGAGTATTAAAGCTTTGGAAACACATTGCACTTATACTTCATTCCATGCTGCTTTTTC
TGCTTCGTCCTTTTTGGTTTATTCATTCATTTATATTTTCTAGGTCCACATAGCAACTACAACGTTTTGGTTTCTGTCGGAGTGGCATGGACCAGAACACGAGCTAGCTAGGTACACAAA
TACAAGCCCGTAAACGGGGCTGAGTAGGTAGGAGTTACTTGCAGACGTTTGTTGCGGCTCAAAAGAGTGGATTGTTGGTACTAAGAGGTTTATTCTCCGTAATTTTTGCAGCGCCTGCAA
GGCTCCCTGGTTTCCACACATGTGTTGGCAGTGGTGGAGAGAGGCAAGCACCGGAGTGGTATGCTGATAATG
GTAAGGGACTTGAGAGATGAGCATTCACGACTGGTATAGCAGCGAACT
GTCCAGTAAAAACGGTTTCATCAAGCCATCGCAGAATATCATTTGAAATGGGAACAAGTACTTAATCATGTATACATTTTGTGTAGGCATTGATCTTCACTTGAGCTCCGAGATTGCTAA
GGCAGACACAAAGAGCAAGACCATTACAACTGCGCAAGGGAAAACTTTTGAATATGGTTCACTTTTGATTGCAACTGGCTCTACA
GTAAGTCTCTAGTTGCCACTTGTTTGATAACTCTT
CAAACCTTTGCATTCATAGTATTCACCGTCTCCTTACATGAACTTCCTTAACTTGCTATTCATACGTTGCGTGGTATGGCTTGCAGTTTATTAACCTGGCCGACTTCAAGACTCCTGGAG
CTGATGCTGGAGGTATTCACTATCTGAGAGAAAAAGATGATGCCGATAAGCTGGTGGAAGAGATTGGAGCCAACAAAGGAGGCGAAGCTGTGGTTGTCGGAGGAGGCTACATCGGTGTGG
AATTGGCTGCGTGTCTTGCCCTCAACTCAATCAGGGTGACTATGGTGTTCCCTGACCCACATTTCA
GTGAGATTCTTATCCACACCTTAACTGTGACTACCCTACGTGTTATCATTGAGA
CGTGCAACTCCTACCTGTTTAATTTGGCTCTGAAACAAGGCTTTTCACCTTCACAGTTTGCCTTCAATGTTTGCTCATCAACTATGTTCAACCTTCTCAGTCTCCCTTCATATTTTGAAC
TCGGAGACTCGACCTTGTTATTTTTGATGCGTAGATCACACCATGAGGTTTATTCAGCTACATGATTCTGAACGTTTCACTTGCTGATCCGCAGTGCCTCGCTTGTTTACACCGGAAATA
GCTTCGTTCTACGAAAGCTATTACAAGGCAAAGGGTATCAACATCATCAAAGGAACATCCGTGACTGCGTTTGAGAAAGATGATCAGGGCAAT
GTAAATTTCTTACCGACCACACAGAAA
TAATGACATGGAGCGTGTCCATGTCTGTACGTCAAATATCCAGTGAATAACCTCAAGTCTTAAATTCTTGCCGTCGAACCTGAATTTCAGAACCTACTACTGGTCAATGTTGTTTCACCA
TTCTTAATTTTTCTGCTTTTCTATGCATCATCGTTGAACTACGAGTGAAATAATGTCAATTGTCTTGCTTCCAGTCTAAGACGAACAATTGATACAGGTGGTGAAGGTAATCCTGGGAGA
TGGCCGGTCGTTGTCAACCAACCTTGTAGTAGTGGGTATTGGTGCCAGACCTAACCTAGGACCATTCAAAGGCTTGCTGGAGGAAGAAAAAGGTGGCTTCAAG
GTAACAATCTTCAAACC
AACTATTATGTACTTCGGGGAATCAGCATGAGCGGCATGTTTTCGAATCCATGAATCTCTTTCGGAACATGTCACGAACTATCACTTACTTTTTATTTATTTATCGTATGATCACAGGTG
GATTCTTCTTTCAGATCAAGCGCGGAAGACGTGTATGCAGTCGGTGATATTGCAACATTCCCATTAAAGATGTATGGTGACAGGCGACGTGTCGAGCACGTGGACCATGCCCGGAAATCA
GCTATCCAAGCTGTTCAG
GTTTGTAATATAACCCAAGTTTTCGTCCAATCGGTATTCTACCCCGTGTATTCTGGTAATTTAACTCTTACATTTTCGTTGTAAATCACGCCTTTATATTGA
AATGTTCAAATTGTTGCGAATCCAGGCCATCAAAGCCGCTGAGAAAGGCGAAACTGTGGACGACTACGACTACCTGCCCTTCTTTTACTCACGATCTTTCGACCTCTCATGGCAATTCTA
TGGAGACAATACTGGTGATTCTGTCGTCTGGGGTCTAGATGGAGCAAGCGCTTCAGGCTCCAAATTCGGCGCCTACTGGATAAACGATGGCAAAGTAGTGGGTGCATTTTTGGAGGGTGG
GTCTCCTGATGAAAACAAGCTTCTTGCCAGAGTTGCACGACAGAGGCCCTCAGTGAGCAGCAAGAAGGATCTGATCTCTGGCGGCTTGGATTTTGCCGCGAAGATTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACGCAGCTATGCTGAAGTACGTGCTAGTAGGCGGAGGTGTTGCAGGGGGATACGCAGCGCGGGAATTTGTAAAGTTGGGTGTGAATCCTGGAGAGCTTGCAATTTTCTCCAAAGAA
CCG
GTTGCGCCCTATGAACGGCCCGCCTTGAGCAAGGCATACTTGTTTCCTGAATCGCCTGCAAGGCTCCCTGGTTTCCACACATGTGTTGGCAGTGGTGGAGAGAGGCAAGCACCGGAG
TGGTATGCTGATAATG
GCATTGATCTTCACTTGAGCTCCGAGATTGCTAAGGCAGACACAAAGAGCAAGACCATTACAACTGCGCAAGGGAAAACTTTTGAATATGGTTCACTTTTGATT
GCAACTGGCTCTACA
TTTATTAACCTGGCCGACTTCAAGACTCCTGGAGCTGATGCTGGAGGTATTCACTATCTGAGAGAAAAAGATGATGCCGATAAGCTGGTGGAAGAGATTGGAGCC
AACAAAGGAGGCGAAGCTGTGGTTGTCGGAGGAGGCTACATCGGTGTGGAATTGGCTGCGTGTCTTGCCCTCAACTCAATCAGGGTGACTATGGTGTTCCCTGACCCACATTTCA
TGCCT
CGCTTGTTTACACCGGAAATAGCTTCGTTCTACGAAAGCTATTACAAGGCAAAGGGTATCAACATCATCAAAGGAACATCCGTGACTGCGTTTGAGAAAGATGATCAGGGCAAT
GTGGTG
AAGGTAATCCTGGGAGATGGCCGGTCGTTGTCAACCAACCTTGTAGTAGTGGGTATTGGTGCCAGACCTAACCTAGGACCATTCAAAGGCTTGCTGGAGGAAGAAAAAGGTGGCTTCAAG
GTGGATTCTTCTTTCAGATCAAGCGCGGAAGACGTGTATGCAGTCGGTGATATTGCAACATTCCCATTAAAGATGTATGGTGACAGGCGACGTGTCGAGCACGTGGACCATGCCCGGAAA
TCAGCTATCCAAGCTGTTCAG
GCCATCAAAGCCGCTGAGAAAGGCGAAACTGTGGACGACTACGACTACCTGCCCTTCTTTTACTCACGATCTTTCGACCTCTCATGGCAATTCTATGGA
GACAATACTGGTGATTCTGTCGTCTGGGGTCTAGATGGAGCAAGCGCTTCAGGCTCCAAATTCGGCGCCTACTGGATAAACGATGGCAAAGTAGTGGGTGCATTTTTGGAGGGTGGGTCT
CCTGATGAAAACAAGCTTCTTGCCAGAGTTGCACGACAGAGGCCCTCAGTGAGCAGCAAGAAGGATCTGATCTCTGGCGGCTTGGATTTTGCCGCGAAGATTTAG

Retrieve as FASTA