Entry information : PpaMDAR04 (Pp3c14_26470)
Entry ID 13925
Creation 2016-10-18 (Christophe Dunand)
Last sequence changes 2016-10-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-18 (Christophe Dunand)
Peroxidase information: PpaMDAR04 (Pp3c14_26470)
Name (synonym) PpaMDAR04 (Pp3c14_26470)
Class Monodhydroascorbate Reductase    [Orthogroup: MDAR002]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaMDAR04
start..stop
S start..stop
MpMDAR02 612 0 1..486 1..485
HaMDAR02 565 0 1..479 1..474
KflMDAR03 551 0 1..486 1..476
HaMDAR04 550 0 1..454 1..450
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 344089..344208 120 N° 2 343362..343413 52 N° 3 343116..343196 81 N° 4 342903..343021 119
N° 5 342493..342718 226 N° 6 342174..342292 119 N° 7 340943..341686 744  
complement(join(340943..341686,342174..342292,342493..342718,342903..343021,3431 16..343196,343362..343413,344089..344208))


exon

Literature and cross-references PpaMDAR04 (Pp3c14_26470)
Cluster/Prediction ref. Genebank:   5943214 Phytozome Gene 11:   32962836
Protein sequence: PpaMDAR04 (Pp3c14_26470)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   487
PWM (Da):   %s   52919.08 Transmb domain:   %s   o457-479i
PI (pH):   %s   8.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRSFRVVILGGGTASGYAASEFVKHGLNPGDLCVISQEMVAPYERPALSKGYLLAKEPARLPAFHTCVGVGEQSHPAKWFQEKGIELVLGTRVTQANVRDKTLLTAAGETISYSILIVATGAVLKLDEFGVTGADAKNVCYLRDIKDATYLVDAMAECREKGGKAVVIGGGYIGMECAAALHGNRIPVTMVFPEDYCMPRLFTPEIARYYEDYYMKKGIQFRKGNVLSSFECDESDKVTAVILKDGSRIDADIVVVGIGIRPNVDLFEGQLMLEKGGIKVNGKMQSVSNASVYAVGDVATFPMPMYSDVRRLEHVDHARKSAAHAVQAILMGNKVDNYDYLPYFYSRVFTLSWQFYGDNVGDSVLFGDQIVGKFGAFWVHNGRLVGAFLEGGSKVEYAALAKAARERPHVKDISMLKKQGLDFALTVAEPTPQMSLMSSITSSESNLLFTHPSTWALQAGGGLALGLAVVGVIYWFGSRRSRKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 14, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCGATCGTTCAGGGTGGTGATCCTCGGGGGCGGAACGGCGAGCGGATACGCAGCGTCGGAGTTCGTGAAGCATGGGTTGAATCCCGGGGATTTGTGTGTTATCTCGCAAGAAATG
GTGCGTCTGCCAGCAACTGCGTTTACAATTCAATTTGATTTGTCCCTTTTCCTCGTGATTTCGGGTGATTGAGACATGGATATGTTCGTTGAATTTCCGTGTGGATCTGGATCTTTATGA
TTTATTGCTTTAATAGCCATTCTTCGGTGTCTTTCTTGGAACAATCTTCAGCTCGTGACTATGTTGATTTTTATTTGGTTTTTTTTTTCCGGCGGTTGGGCTTTGAGTTCAAAAAAAAAA
ATTAAAAATTAAAAAAGTAAAAATTGGGTCGATCGATGTCTCATCTTTGCGCTGTCGCTCCTATTTCAGTTTTATGGTTCACACGAAAGTCGTTTTGTTCCTTTTACTGGTTATAGCTGT
CGAATTTCGTAGGTTTGGCTGATTTGGTCGCCTGTTTGGTCTAGTGGTCGTCCATTTTGCAACGATCGTTCGCTACGTGCAACTGAGTTAGTCGAGTTTACACTTGTATGTATACGCTCA
ACTAGGAATATTCAACACTGTCTAAATACTGGGGTTTTCGTGTAGTTGAAATGTCCGAATCCACAAGGGTCTGTCGAAGACCTGGAAATAGACTATGGACGCTGTCTGTGCGAGTCATGC
ATACTTTGGTAATATAAAAACTTATTTAGGGCAGAACTATTCCTGTGGCTAACATCTGGAAGATGGATCATGCAGGTTGCACCATATGAGCGCCCTGCTTTGAGTAAGGGATACTTGTTA
GCCAAAG
GTACGTACATGGCAAGTATTATTTTCAGCTTTGCATCATCTAAGTTTGTATGTAATTTCAAATTAACTGTGATGTACTTTTTATTATTTCTTCCAAAAATAAATTATTGGAGC
ATGTTTTGAGTATGGTGGCAAAATCAAGCGTTGGTTTGTGGTTGTGAAGCAGAACCTGCGCGGTTACCTGCTTTTCATACGTGTGTGGGTGTGGGGGAGCAATCGCATCCTGCTAAATGG
TTTCAAGAAAAAG
GTAATTCATCCTCCCTGCCATCGTATGCCGCCAGATGATTGCAACGATTTGGTAAGCTTAAGGAAGCTCACCCATCAACATCTTACGCTTGCAGGGATCGAGTTGGT
TTTGGGAACTCGCGTTACACAAGCAAATGTTAGAGATAAAACTCTTTTGACTGCTGCGGGTGAAACCATTTCGTACTCCATCCTGATTGTTGCAACGGGCGCTCGG
GTACGGCCCTATTT
TCCCTGTACATAGGAAGTTAATTTGGGCTCATTTCTAAAGAGACATGATCTCCAAGTAGCACGTCCTTTATGTGGATTATTCACTGTTTAGATATACTCCTCGCTCGGGGCGTAAGCCGG
AAGTAGATTTTGAAATGTAATTGAGGTCTAAGATTTTCGGAATTAAGCAGGTTCTGAAGCTGGATGAGTTTGGGGTCACGGGAGCAGATGCAAAGAACGTTTGCTACCTTCGAGACATCA
AAGATGCGACGTATCTCGTGGATGCGATGGCAGAGTGTCGGGAGAAAGGCGGGAAGGCTGTTGTGATTGGCGGTGGCTACATTGGGATGGAGTGTGCCGCAGCCCTCCACGGGAATCGTA
TTCCTGTGACCATGGTGTTCCCGGAAGATTACTGCA
GTAAGAATCAATTGCCCCTAGTTTATCAGGGAAAATATGACGTGATTTCAACATTATCACTGCAGTATCCGAATTAGTGAGAGT
GGCTTCTGGTTTTTGAGAGACATTGAGGTGGAGTGGACTGTAGTTGGATGCGTGATGAGGTTGCCATTGGCATACCACGTCCAGAGTATTCTAAATGGACTTGGTGGTATTTACAGTGCC
TCGCTTATTTACACCAGAGATTGCAAGATATTATGAAGATTACTACATGAAGAAGGGTATACAGTTTCGAAAAGGGAACGTCCTGTCTTCATTTGAGTGCGACGAATCGGACAAG
GTATC
ATTTCGCCCATTAATAAAAAAACTGATGGTATTTATAACTCTTTTGGTAGCCAATCGATACGCGCTGTCGCCGTCATGTTTTATGTGGTGTTCGTACTAGGTAGTTGTCATGTTCGTACT
ATTATAAGTTTGTATCAGTCCAACGCATTGAACACCTCGTACCATATGCATGTGTCCTTCAAAGCTTAGGAATGACGTCTCCTCATGTGTACAGATATCTACATCTATGTGTTAGATTTC
TCCTTACCTCGTGCCATTGTAAGGATTTGTATCATGAGTTCGAAGAATGTCATGATGCCTCGGAATTTATTATCATTATTATTATTATTATTTTTGTAGGTGTCGCCTTAGTACTAATCT
GATGCTCATTTTGCTTACTGGTGCAATTGTGCCATGTCTGCCCTTTGGGATGGAATGTCTACCATCACCGAACCCATATTCTCACCCTAAAGCGGTGTTTACGATGTTTTACGATGTGCC
AGGTGACTGCAGTCATACTGAAAGACGGAAGTCGAATAGACGCAGACATTGTGGTTGTGGGCATCGGTATACGCCCCAACGTGGACCTTTTTGAAGGGCAGCTCATGCTGGAGAAAGGGG
GCATCAAAGTGAATGGCAAAATGCAAAGTGTGAGCAATGCGTCCGTGTATGCAGTGGGAGACGTGGCGACCTTTCCCATGCCGATGTACAGCGATGTGAGGAGGCTGGAGCATGTGGATC
ACGCTCGCAAGTCTGCAGCTCACGCTGTGCAGGCCATCCTGATGGGGAACAAAGTGGACAATTACGACTACCTTCCTTACTTCTACTCCCGGGTCTTCACGCTGTCGTGGCAATTCTACG
GCGACAACGTGGGTGATAGTGTGCTATTCGGTGACCAAATTGTAGGCAAGTTCGGGGCTTTCTGGGTGCACAATGGGAGATTGGTAGGGGCGTTTCTGGAGGGAGGGTCCAAGGTAGAGT
ATGCGGCACTAGCCAAGGCAGCCAGAGAACGGCCACATGTAAAGGATATTAGTATGTTAAAGAAACAAGGTCTTGATTTTGCACTGACGGTAGCGGAGCCTACTCCACAGATGTCATTGA
TGAGTTCTATCACCTCGTCCGAGAGCAACCTCTTGTTCACCCACCCTTCGACGTGGGCGCTTCAAGCAGGTGGTGGCTTAGCCCTAGGATTGGCCGTTGTTGGGGTTATATACTGGTTTG
GCAGCAGGAGATCCAGAAAACTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCGATCGTTCAGGGTGGTGATCCTCGGGGGCGGAACGGCGAGCGGATACGCAGCGTCGGAGTTCGTGAAGCATGGGTTGAATCCCGGGGATTTGTGTGTTATCTCGCAAGAAATG
GTTGCACCATATGAGCGCCCTGCTTTGAGTAAGGGATACTTGTTAGCCAAAGAACCTGCGCGGTTACCTGCTTTTCATACGTGTGTGGGTGTGGGGGAGCAATCGCATCCTGCTAAATGG
TTTCAAGAAAAAG
GGATCGAGTTGGTTTTGGGAACTCGCGTTACACAAGCAAATGTTAGAGATAAAACTCTTTTGACTGCTGCGGGTGAAACCATTTCGTACTCCATCCTGATTGTTGCA
ACGGGCGCTCGG
GTTCTGAAGCTGGATGAGTTTGGGGTCACGGGAGCAGATGCAAAGAACGTTTGCTACCTTCGAGACATCAAAGATGCGACGTATCTCGTGGATGCGATGGCAGAGTGT
CGGGAGAAAGGCGGGAAGGCTGTTGTGATTGGCGGTGGCTACATTGGGATGGAGTGTGCCGCAGCCCTCCACGGGAATCGTATTCCTGTGACCATGGTGTTCCCGGAAGATTACTGCA
TG
CCTCGCTTATTTACACCAGAGATTGCAAGATATTATGAAGATTACTACATGAAGAAGGGTATACAGTTTCGAAAAGGGAACGTCCTGTCTTCATTTGAGTGCGACGAATCGGACAAG
GTG
ACTGCAGTCATACTGAAAGACGGAAGTCGAATAGACGCAGACATTGTGGTTGTGGGCATCGGTATACGCCCCAACGTGGACCTTTTTGAAGGGCAGCTCATGCTGGAGAAAGGGGGCATC
AAAGTGAATGGCAAAATGCAAAGTGTGAGCAATGCGTCCGTGTATGCAGTGGGAGACGTGGCGACCTTTCCCATGCCGATGTACAGCGATGTGAGGAGGCTGGAGCATGTGGATCACGCT
CGCAAGTCTGCAGCTCACGCTGTGCAGGCCATCCTGATGGGGAACAAAGTGGACAATTACGACTACCTTCCTTACTTCTACTCCCGGGTCTTCACGCTGTCGTGGCAATTCTACGGCGAC
AACGTGGGTGATAGTGTGCTATTCGGTGACCAAATTGTAGGCAAGTTCGGGGCTTTCTGGGTGCACAATGGGAGATTGGTAGGGGCGTTTCTGGAGGGAGGGTCCAAGGTAGAGTATGCG
GCACTAGCCAAGGCAGCCAGAGAACGGCCACATGTAAAGGATATTAGTATGTTAAAGAAACAAGGTCTTGATTTTGCACTGACGGTAGCGGAGCCTACTCCACAGATGTCATTGATGAGT
TCTATCACCTCGTCCGAGAGCAACCTCTTGTTCACCCACCCTTCGACGTGGGCGCTTCAAGCAGGTGGTGGCTTAGCCCTAGGATTGGCCGTTGTTGGGGTTATATACTGGTTTGGCAGC
AGGAGATCCAGAAAACTGTGA

Retrieve as FASTA