Entry information : CbraGrxC01 (g8628/CHBRA15g00780)
Entry ID 13952
Creation 2016-10-19 (Christophe Dunand)
Last sequence changes 2016-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: CbraGrxC01 (g8628/CHBRA15g00780)
Name (synonym) CbraGrxC01 (g8628/CHBRA15g00780)
Class CGYC Grx    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Charophyceae Characeae Chara
Organism Chara braunii    [TaxId: 69332 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CbraGrxC01
start..stop
S start..stop
HaGrxC25 108 1e-30 1..91 9..98
KflGrxC01 107 4e-30 1..90 23..111
ThasGrxC02 104 3e-29 1..99 9..106
MpGrxC03 101 4e-28 1..91 9..98
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4077207..4077474 268 N° 2 4074863..4075032 170 N° 3 4072200..4072472 273  
complement(join(4072200..4072472,4074863..4075032,4077207..4077474))


exon

Literature and cross-references CbraGrxC01 (g8628/CHBRA15g00780)
Protein sequence: CbraGrxC01 (g8628/CHBRA15g00780)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   237
PWM (Da):   %s   25781.3  
PI (pH):   %s   7.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVQTEPVLLFSKTYCPYCGRVKKLLRDLGVKCATVVELDERDDGETLQRALEELTGQSTVPSLFVGGKHIGGCEETMAAHENGYLTRALKQRLAKMASTQEEKPETEQAVEVLPPGLGPMAAIGRKLTPQDIPDHLKDRIGGHPNEVQEIEGKAITLEDAGEVRRIEEKSGHDIGKGSLPARMQSAAMTNIRENIVPSSDLNKRGLRSEKEANKESAKLAATGSKEMRTKNTKLRG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGCAGACCGAGCCGGTTCTGCTGTTCAGCAAGACGTACTGTCCCTACTGCGGGAGAGTGAAGAAGCTGCTAAGAGATCTGGGCGTAAAGTGTGCCACTGTTGTGGAGCTCGATGAG
AGGGATGATGGGGAGACCCTTCAGCGTGCTCTGGAGGAGCTGACGGGCCAGAGTACCGTCCCCTCGCTATTCGTTGGCGGAAAGCACATTGGGGGTTGTGAGGAGACGATGGCAGCCCAT
GAGAATGGGTATTTGACCAGAGCCTTAA
GTGAGCAGGGCACAGTGTCACTCAATTGATTTCTGAACGGGTGGGTTTTGAGGAGACGCTGGCAGCCCATGAGAATGGGTATTTGACCAGAG
CTTTAAGTGAGCAGGGCACAGTGTCACTCACTCAATTGATTTCTGAATGGGTGGCTCCCTTTTTCTCGTTCTTGGCGTTTCTTTCTTTTATGATCAGTCAGTGTCGAATGGGTGGGACGG
GGATCCAAGGATTTGGGGGGGCGGATGGGGGAAGGGGGAAAGGGGGCAGGGAGGGGTTATGGGGGCGACAGGAAGAGGGGTACTACTGTCTTACCCTGAAGATACTGCACCCTAATAATA
CATGAATACAAGCTGAAGGGGGGAAGGGGGAAAGGGGGGAGGGAGGGGTTATGGGGGCGACAGGGAGAGGCCTGGGGTACTCTACTGTCTTACCCCGAACATAATGCACCCTAATGATAC
ATGAATACAAGCTATATTTCCGGTCCGTCTGGGTAGAATTCTGAAGTGTCCGGCCTCGACTCCACAGCTTGGTAATATGAATTTGATTTCGAGCAAAAACAAAAACCAGAAAAAAAGAGT
GTGTGTTGTGTTCGGGGGAAGATTGGAGGTGGAACCTCTCTCCTCCGCCGCTTCTGTATGAAAAAAAAAAAGAAAAAAAAAAAGAAGTTTTAGTCCGAACGCGTGCATGTGCTCCTCCGC
CGCTTCCGTAATAAAAAGAAATGAGTTGCAGGTGTGGAATACCATAACCATTAGGGGCAGGGGGCAACATGAAATCTCCCCTTCACCTGTCTCTTATACACATCTAGATGTGTATAAGAG
ACAGGTGCGCTGATCGTTGATGCGTGCAAAAAAAAAAAAAAGTGGCCGCCTGATTTTGCGTCCGAGCAATGGCTAGAAGTGCACAAAGCTGTCCTAAGACTTCTGTTTTTGCACTTTCTA
ACTGCCCTTCCTCGGCCCAGACCCACAGTGCCCTGTTTGTTCTTCCTTGAAGTTCCTGCTAATTAGGAACTGTCCACCGGTCACCCCCCCAGTTATTTCAACCAAAAACCCAAAAAAAGT
GGTTCCCTTTCATAAGTTTTACTAACTTCGAACACAATTGTGTCGAACACAATTGTAATTATAATCTTCTTAGTCTCTCAGGCATATAAAAAAGCACACCGTTTGTCATGCGGGAGCTCG
CCAGTGCCCTTTCTTGGTATGGCATTGCTCTCTCTTGTGTCGAGTCTATTGACCGTTGCACTCTGATGTTGTTAGACGAAGTCCAGATTCAATTTGTTGCAGTGTTGTGGGTGCAGACAT
GATGGACTTGGCGGCCTGGTTCCCGCTCGTCTAGCCTTTTCTAAACAAAGGGCGCCTGGATCTTTGAACCTGCCATCCTGTTCTCTACGGTCTTCAGCCGAATAGAACGCCTCGTCATTA
TTGCAGAATCTAGACGGAAAGCTGCACCATATACAGCTATAATGGCAGGCTTTCTATGGGGAAAAGATGGTAGTCATGATTAGGGTCTCCGCAGCATGTTAATGGACCCGATGGCTTTGT
AATTGAATGCTGCAGCTGTGCTGTTTGACAAAGACCAAGCCGACATTTCGTGTTTATCGCACAAAAGTGCGAGTTGAGGCAAGGCACGTCTGTTGTGTCACTTCTTCCAGGCGGGAGGGA
GGAAGGAGGTCGTGAGATTCAATTGTGTTCGACGTGTTGTCATTGCTGTGGTAAATTACAGTTTATACACTCACTCTGGCTTGAAGGGAGAAGTGGGGACCACCACCACACTGAGTCGGA
TGATGTTTCAACTTGAAAGCACAACACGCCTTACAGGAGGAGAGAGAGGGAGAGAGAGAGAGGGGGGGAGAGAGAGAGAGAGGGGGGGGGGGGGGGGGGAGAGCCAGTGCTCTAGGCTGA
GCACATAGTACCTGTCTCTATTTTGGCAAATAATTTTTTTGATTTGGGCTGCCTGCATATTATCTGTTTCTATTGGGGGTAACCGTTGTCATCGATAGACTAAGGATGCTCATCTGGCTA
GCAGGGAGACAGGAAGGAGCGCCAGAGAACCTGACGGTTGCAGAATTCTGTAAGGCAGGACAAATCTCAGGACAGGACATGCGAAGGGGGAGTACGGCTGGTGTGTTAGGCTGCCGTGAA
TCGCAGCGCAGGTGAGAATTTGACAAGAGTAGGGTACGGCAGAGCAAAGATTAGCAAAGATGGCTTCTACACAAGAGGAAAAGCCAGAGACTGAGCAAGCAGTGGAAGTGCTTCCCCCAG
GTCTGGGCCCGATGGCAGCCATTGGAAGAAAGTTGACGCCACAGGATATTCCAGACCACTTGAAGGATCGAATTGGTGGCCACCCGAATGAG
GTATGTGTGGGACAGTTCATTTAAATGA
TGCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATATTTGTATTATTGTTGGAATAGGGTTT
AAGCTTTCTTTAGTTCCCTTTCATAGATGGAGTCCCGATGTTTATGAAGGAGTGTGATTCGTTTAATTTTTTTTTCTAAGGCCAACACTCTCCCACACACCACACACAACCAACTCTCAT
GAATTCACACCCGTGTTTGGTCACTATAGACCCTATTAATAATACTGATCGGGGGTATCAAGCGGACTATCACAGCCGGTTGGCGGCACTAAGTGCGCCACAGGTGGTCATGGGGCTCGA
ACCCACGACCTCCTACATGCCACTTGCGCGCTTAACCAATTGAGCTAGGCCGCTGGACATCGTTTTTTTTGTCGTTGCCCGCTTCCTAACCTGCCTTTTTAAACCATTGCCCCTTCCTAA
CCTGCCTTTTTAAACCACCAGTACTTCCTAAAGGCGTGCCCGTTAACGCGCCATGATTTTAGGAAACGTATGGGCCACTACAGGAGCGCCCAAATTCATCCCGGGGCCGATAGCTGGCCA
AAGTACTGATGGCTTAAACGATTTCCCTCTGCGGAATGAGCCGGTTGTGTAACATGTGTTAACTGCCAGCGCAGACATGTTGCTTTTGAAATCTTCTCCCCTTTTTTGGAGCATTTTTGT
TTTATTCGGTGTCTTAACTGGATTTTCCGATGTTTTTTTTTCTTTTTTGTTGGGTTACGTACACGGTCTTCTTGTGTGCCAGGTGCAAGAGATTGAGGGGAAGGCCATTACTCTGGAGGA
TGCTGGTGAAGTTCGGCGAATCGAAGAAAAGAGTGGGCATGATATCGGAAAAGGCAGTCTCCCGGCGCGAATGCAATCCGCAGCGATGACCAACATCAGGGAGAATATCGTACCAAGCAG
CGATTTGAATAAGCGTGGCTTGCGAAGCGAAAAGGAGGCAAACAAAGAGAGTGCCAAGTTGGCAGCGACAGGTTCCAAGGAGATGAGGACTAAGAACACAAAGCTACGAGGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGCAGACCGAGCCGGTTCTGCTGTTCAGCAAGACGTACTGTCCCTACTGCGGGAGAGTGAAGAAGCTGCTAAGAGATCTGGGCGTAAAGTGTGCCACTGTTGTGGAGCTCGATGAG
AGGGATGATGGGGAGACCCTTCAGCGTGCTCTGGAGGAGCTGACGGGCCAGAGTACCGTCCCCTCGCTATTCGTTGGCGGAAAGCACATTGGGGGTTGTGAGGAGACGATGGCAGCCCAT
GAGAATGGGTATTTGACCAGAGCCTTAA
AGCAAAGATTAGCAAAGATGGCTTCTACACAAGAGGAAAAGCCAGAGACTGAGCAAGCAGTGGAAGTGCTTCCCCCAGGTCTGGGCCCGATG
GCAGCCATTGGAAGAAAGTTGACGCCACAGGATATTCCAGACCACTTGAAGGATCGAATTGGTGGCCACCCGAATGAG
GTGCAAGAGATTGAGGGGAAGGCCATTACTCTGGAGGATGCT
GGTGAAGTTCGGCGAATCGAAGAAAAGAGTGGGCATGATATCGGAAAAGGCAGTCTCCCGGCGCGAATGCAATCCGCAGCGATGACCAACATCAGGGAGAATATCGTACCAAGCAGCGAT
TTGAATAAGCGTGGCTTGCGAAGCGAAAAGGAGGCAAACAAAGAGAGTGCCAAGTTGGCAGCGACAGGTTCCAAGGAGATGAGGACTAAGAACACAAAGCTACGAGGGTAG

Retrieve as FASTA