Entry information : KflGrxC02 (Kfl_003300040)
Entry ID 13957
Creation 2016-10-19 (Christophe Dunand)
Last sequence changes 2016-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflGrxC02 (Kfl_003300040)
Name (synonym) KflGrxC02 (Kfl_003300040)
Class CGYC Grx    [Orthogroup: GrxC004]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGrxC02
start..stop
S start..stop
MpalGrxC04 141 3e-45 35..130 5..100
MpGrxC04 140 7e-45 35..130 5..100
MpalGrxC05 144 1e-44 35..130 134..229
HaGrxC24 122 8e-37 5..125 48..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45712..45860 149 N° 2 46332..46405 74 N° 3 46790..46861 72 N° 4 47089..47115 27
N° 5 47306..47382 77  
join(45712..45860,46332..46405,46790..46861,47089..47115,47306..47382)


exon

Literature and cross-references KflGrxC02 (Kfl_003300040)
DNA ref. GenBank:   DF237279.1 (45712..47382)
Protein sequence: KflGrxC02 (Kfl_003300040)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   132
PWM (Da):   %s   14285.25  
PI (pH):   %s   5.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTSHGILEAPSLCRRASLHCKASGSGIVEEVKKKNEENPVIVYSKSWCPYCSQVKGLFRQLGVPAKVIELDENEEEEVQDALYELTRQATVPNVFIGGKHIGGCDDTMALKRSGKLFELLADAGINVTSK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAACAAGCCATGGCATTCTAGAGGCGCCTTCCCTGTGCCGCAGAGCCTCCTTGCACTGTAAAGCTTCTGGGAGCGGTATCGTTGAAGAAGTGAAGAAAAAGAATGAAGAGAACCCT
GTGATAGTCTACTCGAAGTCATGGTGTCC
GTGAGTTCCCTCCCTTGTGGTTCTTTGATTGCTCTAATAGGGGACTCCTATGACTCAATTGCATTCGGTGATTGGTTTATCTGAGTGCGCT
TGTTTTGAGAAGCTGAAAGAAGCATTTCAGAGAAGAGTCAGTGATTTGCTCTTTCAAGAGTTGCTGCCACCTTTGCGGAGTTGGATGTTTGGAGAATTGAATGATGCCCATGTTGTACCG
TTATTGTCCGCACTTCATTTAGTGCTTCACCACAGCGGAATGCATGCCTAATCCAGCATTCGTTTGTTGTTGTTGTTGTCAGAGAGCATAACTAACCACATCTTTCCGCTATTGAGAAGA
TATGCGGACATCGATGCCAGAAGGAGCTAACCAAATGCAAAGTGCTTTTGTAAAAGTAATCTACCTTCTTGTGACTCCTGCAACCATTCATGCGTTTTTGGTGTGCTTCACACGAACAAA
TATTCCCCTTTGCCTTTTAGGTACTGCTCTCAAGTGAAGGGCCTTTTCAGGCAATTGGGGGTGCCTGCGAAAGTGATCGAACTAGACGAAATCAGTGAGTTGCTCCTTGATAGCTTACCT
AGAGCAGATGGCTTCGTTTCCTGTTCTTTGAATCTCTTTCTTTCTCCCCCGACTCTGTCCTTCCGCCCCCGAAGTCAGGCGCTGTGTTCAAGTACCACGACATTGGATAGAATGCAGCAT
CAAGATGTTCGAAGAAGGACAAACAATCAAGTTCTATCGATTTTGGCATCTTGCATCTGTTGGCTGTGGTCTGAGCCACCTCAGGGTAAAAGCGCCTTTGCAGTCCCAGGTATGTGTTTG
CAGTCCCCCATATTTGAGCGAGTTACCCATCTGCAACCAGAGTAGTCTGCCGGTGACTCCCGTAGAGTTGTACTGTGTTGAGCCTGCCTAAGTGAATTCTTTCCTGCTCCATTTGCAGAT
GAAGAGGAGGAGGTACAGGATGCTCTCTACGAGCTCACGCGCCAGGCAACAGTTCCGAACGTGTTCATTG
GCAAGTCGTCCTCACCTTCGACACCTCAGCTTTTGGATGTCTTATCGCAT
TATGCTCACATTGGCTGCCTGCATATGGACTGCTATTTCGCCAGCTTCGACAGCCTCTAGTACTGGTTGCTTTCGAGATGAATACAGGGTCGAGCAGCCTGTTTGGCCACATCGAAGGAG
TCGGAAGTCTCCCCTGCGCACCCGCAACCAAACTGACATTCTGGCGTCTATCTGCAGGGGGAAAGCATATTGGTGGCTGTGATGGTGAGTTGGCCTTCTTTTCTCTGCCGCTTATTGCGA
GTCTCCGAAAATTCGACCAACTTCACAGCCCATCTTCTACTAGCGTAATCACATCGTTTTTGTCGCCTCGATACTGCCCCTCAGCCTGCTCCAAAGCCCCACTTCTGGTCGTACCATTGG
TTCAACAAGTCATATTGGCCGTTTGTCTTTGCAGATACGATGGCTTTGAAAAGAAGCGGTAAGCTCTTTGAGTTGCTCGCGGACGCGGGCATAAACGTGACGTCAAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAACAAGCCATGGCATTCTAGAGGCGCCTTCCCTGTGCCGCAGAGCCTCCTTGCACTGTAAAGCTTCTGGGAGCGGTATCGTTGAAGAAGTGAAGAAAAAGAATGAAGAGAACCCT
GTGATAGTCTACTCGAAGTCATGGTGTCC
GTACTGCTCTCAAGTGAAGGGCCTTTTCAGGCAATTGGGGGTGCCTGCGAAAGTGATCGAACTAGACGAAATCAATGAAGAGGAGGAGGTA
CAGGATGCTCTCTACGAGCTCACGCGCCAGGCAACAGTTCCGAACGTGTTCATTG
GGGGAAAGCATATTGGTGGCTGTGATGATACGATGGCTTTGAAAAGAAGCGGTAAGCTCTTTGAG
TTGCTCGCGGACGCGGGCATAAACGTGACGTCAAAATAA

Retrieve as FASTA