Entry information : KflGrxC03 (Kfl_002350020)
Entry ID 13958
Creation 2016-10-19 (Christophe Dunand)
Last sequence changes 2016-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflGrxC03 (Kfl_002350020)
Name (synonym) KflGrxC03 (Kfl_002350020)
Class CGYC Grx    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGrxC03
start..stop
S start..stop
KflGrxC01 96 3e-27 2..93 5..96
ThasGrxC02 81 2e-21 13..92 2..81
MpGrxC02 80 6e-21 13..95 2..84
HaGrxC23 80 1e-20 13..95 20..102
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7576..7664 89 N° 2 6704..6792 89 N° 3 6174..6272 99 N° 4 5769..5893 125
complement(join(5769..5893,6174..6272,6704..6792,7576..7664))


exon

Literature and cross-references KflGrxC03 (Kfl_002350020)
Protein sequence: KflGrxC03 (Kfl_002350020)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   133
PWM (Da):   %s   14236.27  
PI (pH):   %s   4.47
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASNVGAAAAAALKFVRGVVETNPVALFGKTYCPFTRKVRVLFNELGAKYKETDLDVENGDILQLVLTKATGQPTVPYVFIGGDFIGGADEVVPAREEDADDCLDLYTKQTYEGLEEVRMTAGTYKKVTSS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGTCGAACGTCGGCGCGGCCGCGGCCGCGGCTCTGAAGTTCGTGAGAGGCGTCGTGGAGACGAACCCCGTCGCACTGTTTGGGTGAGGAATGCAGAATGAAACGCATTTGAGA
GGCTTGCATGCAGCCCTGATATTGGGCGTAAATTGCTCTCTCCATCTGCTGACTGTCTGCTCTGAAATGTTTCTTGACTTCAGTGAGCTCGATCCCGACGTGGCCGCTGCATGCTTGAAA
TGCAGGGTAGTGTAGACGCTAGGGTGATGATGAAGGCCAAAACTTATGCTTTCTACAAAAGCAGATTCTTGCAAAAGACTTTGCATCTCCCTCTTCAATCACAGACCAGGCCAACTGAAT
TTGTTTATGCGCTTGATACGGTGTGCAAAGACAGCACGACGTTGTTGAACGCCTGCATCACATGCGAAAGGACCTGCGTTCGTTGGGAATGCTCGAGAGGACATGGAAGTAATCTGCGAA
GATCAGTTGCGCTCGGTTGAGTCTCTGTGTAATTACTTGCGGATTCATACGCCTTCGAAGTTGCCCAGGTCGTCGAGCGCAAAAAGGATTCCCGACAATCAAACCTTTCAGCAGGTTCGA
TTGCTACAGCACGCCGGTCATTAAAAAAAGCCATCCCCAGATGCGCGAAGCGTCACGGTATTGGTCATTCTCAGAGGAGTTTCTGCTCGCGTTTGCCGCGTCAAGCCCAAAGCCGTGTTC
AACCTGGTTGAAATGGGAAAGTTCTTCTCGTCTTCTCTGCAATATTCAAGGTTAATCAAAGAGGCTGAAAAACTAACGTCACTAATCCCTTTTTTGAGCAAGACCTGCTGCTTATCCTCT
TAAGTAAAACGCCGTAACCCCCTGTGCTTCAGCAAAACCTACTGCCCGTTCACCCGGAAGGTGCGCGTGCTCTTCAACGAGCTGGGGGCCAAGTACAAGGAGACGGACCTGGACGTGGTC
G
GTAAGAAAACAACCAGATCCGTTCCGTTCCGTCCGTTCCGTCCGTTCCGTTTCCGTTCCGTCCCATTCAGTCCGTTCCGCTGTTCTTGCTCCGCCGCTTTCTCGGTTGAAGAGGCCGGT
TTCTAAAGCCGGTATTCTTCTGATCCTTCACCATTCTGCACAGATCGTAATTTACGGCGATGGAAGCCTGAAGAGGTCGTGTAGCAAGTTACTTCAGCATTTAGAAGGCGGTCGTATCGA
CTACTGCTCTCTCCCTCGGATGCTTGTCCAATCCAGTCCTTCCATTCTTCCGTTCTGCTCGCGCTTGTCTGTTCCGCTCGCACTTGCAGAGGGCCACATTGTGCAGCTCGTGATCACTCT
GCCGTGCCCATTCCGTTCAAATCCGTTCCAAGTTCGTTCCGCTCACTTCATCTTTCCGTCCGGCCGTTGCAGAAAACGGCGACATCTTGCAGCTCGTGCTGACCAAAGCCACGGGGCAGC
CCACCGTGCCGTACGTCTTCATCGGGGGCGACTTCATCGGCGGGGCTGACG
GTGAGCGTTTTTGGAGCCCCCAACACGTTTATTCCGTCAAATAGAGGGAATCTCTCTTTGAGATTCCTG
ATTTCAACACAAAAGTTGACATAAGATTCTTCCAATCTTTATAACCTTGTCAATCTCTTCACCTCTTGATGAAGTTTCGTCTCAAGTCCTGTTTCAACCGCAAAAAGCTTGACACTGGTT
GTAGAGCGAAGAAACACCGGATTCCAAGCTTTGAGTTGTGATGCCAGTTGGTTAGAGATCTCTGAGGGCCTTTTGTGCCCCTGTCCTGCAGAAGTTGTGCCGGCCAGGGAGGAAGACGCG
GACGATTGCCTGGATTTGTACACGAAGCAAACGTACGAAGGGCTTGAAGAAGTTAGGATGACAGCTGGCACCTACAAGAAAGTGACGTCATCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGTCGAACGTCGGCGCGGCCGCGGCCGCGGCTCTGAAGTTCGTGAGAGGCGTCGTGGAGACGAACCCCGTCGCACTGTTTGGCAAAACCTACTGCCCGTTCACCCGGAAGGTG
CGCGTGCTCTTCAACGAGCTGGGGGCCAAGTACAAGGAGACGGACCTGGACGTGGTCG
AAAACGGCGACATCTTGCAGCTCGTGCTGACCAAAGCCACGGGGCAGCCCACCGTGCCGTAC
GTCTTCATCGGGGGCGACTTCATCGGCGGGGCTGACG
AAGTTGTGCCGGCCAGGGAGGAAGACGCGGACGATTGCCTGGATTTGTACACGAAGCAAACGTACGAAGGGCTTGAAGAAGTT
AGGATGACAGCTGGCACCTACAAGAAAGTGACGTCATCGTGA

Retrieve as FASTA