Entry information : KflGrxC04 (Kfl_000940060)
Entry ID 13959
Creation 2016-10-19 (Christophe Dunand)
Last sequence changes 2016-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflGrxC04 (Kfl_000940060)
Name (synonym) KflGrxC04 (Kfl_000940060)
Class CGYC Grx    [Orthogroup: GrxC005]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGrxC04
start..stop
S start..stop
AtGrxC04 146 1e-46 6..132 9..133
HaGrxC03 143 2e-45 6..131 10..130
MpalGrxC01 143 3e-45 12..124 26..136
MpGrxC01 138 3e-43 23..124 38..137
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27400..27548 149 N° 2 28026..28105 80 N° 3 28585..28683 99 N° 4 28970..29058 89
join(27400..27548,28026..28105,28585..28683,28970..29058)


exon

Literature and cross-references KflGrxC04 (Kfl_000940060)
Protein sequence: KflGrxC04 (Kfl_000940060)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   138 (115)
PWM (Da):   %s   14405.46 (12135.1)  
PI (pH):   %s   5.15 (5.11) Peptide Signal:   %s   cut: 24 range:24-138
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAALVILVLAGLLIAVPQEVGASSDEALQFVKQFIAEHPIAMFSKSYCPYCARAKQAFKALGPDAEPAVVELDGEDGYAIQDALGELVGRRSVPQVFIDGFHIGGSDDTVDAYQSGKLAKLVAKATGKAASAFNTK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCTGCCCTTGTAATCCTCGTCCTCGCCGGCCTCCTCATCGCAGTCCCTCAAGAGGTTGGGGCATCCTCTGATGAGGCGCTCCAGTTTGTCAAGCAGTTTATTGCGGAACACCCG
ATCGCAATGTTCAGCAAGTCCTACTGCCC
GTAAGCTTCCTCTTCATCACATTTTAGACTTTGGGTTGGGTTTTGCCTTGAAATGTTAGAAACGATGCGACCTGAGCATGCAACTCGATTG
CAGTTTAGATTGCTGGAGGTTCCAATCCTGCGTACTGGGTGTCTCTGGGGCTTGGCAAGCCTCTTAACTGGCTATTTCACTCTGACCTGAATCACCTCTGATCACGCTCACAAAGGCCGG
AGAAGCTGGAGAGCAGAGGAGACCATGGTGTAACGCATCATACACGCTTTAGGTTGGGGACGAACAACTTTGCCGTTTCAGCATGAAGTTTTCCTTCTGATCATCCAAGAATACCTGCAC
AGCATCTTCCAGTAGGTCACAAAGTGTCGCTGTCTTTGGACATGGAATTCACCTGCCCCTCGACAACCAGACACACGGGATTGAATTCCAATCCAAGGTTTCAACGTGGATAGCATTTTC
ACAATTGAGTGGGCTTGTCATGGCAGGTACTGTGCGAGGGCGAAGCAGGCGTTCAAGGCTCTAGGGCCCGATGCTGAGCCGGCAGTGGTGGAACTGGACGGCAGAGGTGAGAGCAGGTTG
ACCCAGAAAAGCCTCGAGCGTAGATCAACTCAAACATCGATTCATTTTGCAGGTGGTGACCACAAGGCAATTGAAGTTAGAATGTCGGTTTAGCCTGCAAGGGGCACAATGGTGCATGTT
TCGTTGTGTTGTAACTGAATAATCTGTATGTTGGCGACTTCTCATCAATTCAGTTTCGTACTTGCACTGGGTTGATTTGGCCCTGTTGGTTTTGTATGTGACCTAGTTCTCTGTTCCAGA
TCAGGCAAAGAGTCCGCCTAAGCAGGCGGAGTTGTGGAGACCCATTCGATCCCTGGTTGAATCTTGAATTGTACATTGACCTCCTTTCCAGTTTCTAGCAAGCGTTTCTCTTGGCAAACA
TGGGCGAAGAAGCTGATCTTTCGAGTGATCTAAAGCTTCTGCTTTGCGTGCTCTTGATTCTCATTAATTGGGGACTGGTCTTGATGCTCTTCACATCTGTCACAGAGGATGGTTACGCGA
TCCAGGATGCACTTGGGGAACTTGTAGGCCGGCGCTCCGTTCCTCAAGTCTTTATTGATGGCTTTCATATTGGTGGCTCTGATG
GTAAGTTTTTTCAACCCCTTACACTTGCAGTTTCTT
GTATCAAAGCTGTCTTCGAGATAAATGTGCTCTTGTGTGTGTGCAAGTAGAAGTCAAGCTCAATAGAACCAATGAAAGAAAGAATACTTGTACTAGAGTATGCTGCTACGTTTAAAGGCA
TGCATGCTACCTGAAGAATCCAGACGAAAAGTGGGAAGATGATTGACAAGCTTTGAAAGTTGACGGCAGTTGCGGAAAAGATTGGGTTCATGTCTCTTAGTCAAATTGTGGTCTTCACGT
TTGCATGCAGATACGGTGGATGCTTATCAAAGTGGTAAGCTTGCCAAGCTAGTGGCAAAGGCTACTGGGAAAGCTGCTTCGGCTTTCAATACCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCTGCCCTTGTAATCCTCGTCCTCGCCGGCCTCCTCATCGCAGTCCCTCAAGAGGTTGGGGCATCCTCTGATGAGGCGCTCCAGTTTGTCAAGCAGTTTATTGCGGAACACCCG
ATCGCAATGTTCAGCAAGTCCTACTGCCC
GTACTGTGCGAGGGCGAAGCAGGCGTTCAAGGCTCTAGGGCCCGATGCTGAGCCGGCAGTGGTGGAACTGGACGGCAGAGAGGATGGTTAC
GCGATCCAGGATGCACTTGGGGAACTTGTAGGCCGGCGCTCCGTTCCTCAAGTCTTTATTGATGGCTTTCATATTGGTGGCTCTGATG
ATACGGTGGATGCTTATCAAAGTGGTAAGCTT
GCCAAGCTAGTGGCAAAGGCTACTGGGAAAGCTGCTTCGGCTTTCAATACCAAGTAA

Retrieve as FASTA