Entry information : KflGrxS01 (Kfl_000240220)
Entry ID 13992
Creation 2016-10-25 (Christophe Dunand)
Last sequence changes 2016-10-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-25 (Christophe Dunand)
Peroxidase information: KflGrxS01 (Kfl_000240220)
Name (synonym) KflGrxS01 (Kfl_000240220)
Class CGFS Grx    [Orthogroup: GrxS002]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGrxS01
start..stop
S start..stop
MpalGrxS03 179 1e-58 1..172 1..168
MpGrxS03 174 1e-56 1..172 1..168
AtGrxS14 157 4e-50 5..170 7..168
ThasGrxS14-2 154 1e-48 27..173 24..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 143771..143840 70 N° 2 143308..143456 149 N° 3 142728..142827 100 N° 4 142284..142350 67
N° 5 141857..141935 79 N° 6 141520..141582 63  
complement(join(141520..141582,141857..141935,142284..142350,142728..142827,1433 08..143456,143771..143840))


exon

Literature and cross-references KflGrxS01 (Kfl_000240220)
Protein sequence: KflGrxS01 (Kfl_000240220)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   175
PWM (Da):   %s   19431.8  
PI (pH):   %s   6.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSFSRAVSRHLRVDNTKTSSLTGFSFAPARWIQGATSSTTDTEAGEADTHDDFKPRYKKEDEIPTIHQLIEDVKGNPVMVYMKGVPDAPMCGFSRAVVQILKAYEVPFSSRNVLQDEELRQGVKSYSKWPTIPQVYVNGEFIGGCDILVNMSTGELEPILEEAKKAQSKRVG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGTCGTTTTCCAGGGCTGTCAGTCGGCACTTGCGCGTTGACAACACGAAGACGTCAAGCTTGACAGGTTGGTACCGAAGCTCATCCACAGACTGCTGGGTGAAATCGCAGCGGTCA
CTTATGCATCCTGATAAGAAAAAGGAATGCTGGCAGTCTGGCGATTGTCCTCAAGCATCAAAATTCAGTACATCCATCAGCTTTGCAGTCTGTCAGAGCTCAGGTTTTCAGCAAGTTGCA
CCTGTGCTGAGTGGTGGTGCAGCAATCTATCCCAGTTGAATTCCAGAGTTACTCTTGTTGATTCTCTAAGCATTGGAAGCTGCTTTGTTGACTCAACTGTTGTCACGCGTGCTGATGTAC
CTATTTTCTTGCCTCTTTCGTTAGGCTTTTCTTTCGCACCCGCTCGCTGGATTCAGGGGGCGACCTCCAGCACCACCGACACAGAAGCTGGTGAAGCAGACACACACGATGACTTCAAGC
CTAGGTACAAGAAGGAGGATGAAATTCCAACAATTCACCAGTTGATAGAGGAG
GTAAGCGATCCTCGTATGCGTGTTGAACTTGAAATTAGTGCATGCAACTTTGATTGTATCCACCCAT
TTTAATGGCCGTTGCATACAGTGGTCTGCATCGCACTCGTCCTCTTGCATATGCCAGGCACTCTTTTTCAAGTGATAAGCACAACCACGGCATGGTGGCGTCTTGCGCCTCCTGAGACAG
GGCTCACAGATGGTGCACAGCACTGGAGAAAAGCCAGTGATATCAGCCTGTGCTACTCATGACTGAGAAGAACGCCTCATGTTTGAGCACCCTTCGTCGCCCTGGTACCTTCCAGGAACT
CTTGCTTACCACCAGATTCGAGCTGCAGGTGATTAGCTTCAGTCAGGTTTTTTGACAAATTTCGTCGGACAACACTTGATTTAGGGGCCGCCGCGGAGGTTGAAAAGCAGTCTGCAGATA
ACATCGATTGGATTGAAGGGACATTGAAGATTTCTGCTCAACTTTCATTGCAGGACGTCAAGGGGAACCCAGTGATGGTCTACATGAAGGGCGTTCCAGATGCCCCCATGTGTGGCTTCA
GTAGGGCGGTGGTGCAGATCTTGAAAGCATACG
GTAAGATCCAAAACCAGACGAAGGGCATGATTAGCTGGTCTACCTGGTATCGAATCCAGGCAGCTTCAATCATTCACCAGAATGATG
GAATTCTTTCTGTCTGGTCTGCTCCGAGTTTTTGAGTGCAATTCCTGGCATGTGCCAGTTCTGTTGCCTTCTCTTACAACCTGCGTCCATGCTAGTGTCTGATGTTTTTATGTTCTCCAA
ATCGTCACCATGCTTCGGCGATGGCCTGACATCTAATTCATGGATCTGTGGCACGCACACAAATGGTGTGTGCCCTTTGAGAACTCGGTAAGTCCGTTGGAGAATCAACAGAGTCATGGA
CCGTATGACAAAAGGCAGATAGTCATGCTCACTTTCTTCTTGTTCTGCAGAGGTCCCATTCAGCAGTCGAAATGTCCTGCAAGATGAGGAGCTGAGGCAAGGCGTCAAGTCTTACTCGTG
AGTCGCTCTATTGACTGCCCTCTTTGTTCACCAAGTTCTCGGTCAAGGTGCTTGTGTGGGAAAGATTTTCCGGTTATCTCAGCGACCAGCAGGAAGGGCGACAGCATTTGCAGGGATGCT
GTTCAGAAGTTCGGCTGGGATCTGCCCATCGCTTGCGAGTGACCTGACCCGCTCTTGCATATAAACCTCCTGAAGTTGTGGCTTAATCATCACCTTAATGATTGGCTAAGGTGTTCCGAC
GTTAAGATCTGCCCAAGTGCACGTTAGATATGTGCTGGCGTAATTCTTCAGTTGCATTCTCCTGGATCCATTTCCAATTCGTGACTTGGTTCTTTGGACGTCCAGGAAATGGCCCACAAT
CCCCCAGGTGTACGTGAATGGGGAGTTTATCGGAGGGTGTGATATTCTGGTCAATATGAGCAAG
GTATGAAACTTTCGGATTCTTTCTGAGTGCATCGGGGACGGCATCTTGGCCTTCCA
TCCGTTGTTGTTGCTCCGGCACCCTGCTTGATTCTCGTTCTGTTGCTTGCACAAGACGGCCATGTCTAAGCACCTGCTTTGCTCACTTCCTCCGGTGTTTTCTGGATAAGCGTTTCTTCA
CTCTTAAGAGACAGGAAATTGTATTCTTGGTCAACGCCGCAAGTTTTTGATAACGGATTGTAACGTCCTTAACGGGACCCGCATGTGACTTTTTGCAGACGGGGGAGCTCGAGCCCATCC
TGGAAGAAGCTAAGAAAGCACAGTCCAAAAGGGTTGGATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGTCGTTTTCCAGGGCTGTCAGTCGGCACTTGCGCGTTGACAACACGAAGACGTCAAGCTTGACAGGCTTTTCTTTCGCACCCGCTCGCTGGATTCAGGGGGCGACCTCCAGCACC
ACCGACACAGAAGCTGGTGAAGCAGACACACACGATGACTTCAAGCCTAGGTACAAGAAGGAGGATGAAATTCCAACAATTCACCAGTTGATAGAGGAG
GACGTCAAGGGGAACCCAGTG
ATGGTCTACATGAAGGGCGTTCCAGATGCCCCCATGTGTGGCTTCAGTAGGGCGGTGGTGCAGATCTTGAAAGCATACG
AGGTCCCATTCAGCAGTCGAAATGTCCTGCAAGATGAGGAG
CTGAGGCAAGGCGTCAAGTCTTACTC
GAAATGGCCCACAATCCCCCAGGTGTACGTGAATGGGGAGTTTATCGGAGGGTGTGATATTCTGGTCAATATGAGCAAGACGGGGGAGCTCGAG
CCCATCCTGGAAGAAGCTAAGAAAGCACAGTCCAAAAGGGTTGGATGA

Retrieve as FASTA