Entry information : KflGrxS02 (Kfl_000610430)
Entry ID 13993
Creation 2016-10-25 (Christophe Dunand)
Last sequence changes 2016-10-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-25 (Christophe Dunand)
Peroxidase information: KflGrxS02 (Kfl_000610430)
Name (synonym) KflGrxS02 (Kfl_000610430)
Class CGFS Grx    [Orthogroup: GrxS003]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGrxS02
start..stop
S start..stop
PpaGrxS05 183 2e-61 30..138 8..116
MpalGrxS02 179 7e-59 11..138 67..195
MpGrxS02 179 1e-58 18..138 77..195
HaGrxS04 167 3e-54 9..138 45..174
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 250772..250862 91 N° 2 250180..250449 270 N° 3 249641..249696 56  
complement(join(249641..249696,250180..250449,250772..250862))


exon

Literature and cross-references KflGrxS02 (Kfl_000610430)
Protein sequence: KflGrxS02 (Kfl_000610430)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   138
PWM (Da):   %s   15134.51  
PI (pH):   %s   5.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFMGKTQTVRRTAHSGCRASAGASSGGGSVLTPELRTAVEEFLQEHKVVLFMKGNRQFPQCGFSNTCVQILNMVQVPYETVNILENETLRAGMKEYSSWPTFPQIYIDGEFIGGCDIAIELYQSGELKELVEKALVS

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCATGGGCAAAACTCAGACTGTGAGGCGAACTGCACACTCAGGATGCCGTGCGTCTGCAGGGGCCAGTTCTGGTGGGGGTTCAGGTAATCTACTCCAACTAAGCGGGCTCTAG
AATAATTCGAAGTACATGCTTTGGAGAAATTTGAGGGTTGCAGGATGTTCCTTGTGCCTAGCTTTTGTGGTTGTGCCTGACTTGTGTGATTGTTGATATTTTGGAATGGAGATGGTGTGA
GAAATTGCCCAGCAATCAACATCCCAAATGTCATGGCATTGCTCAGGTTTGGGTGCGTTCTCTGCGCCCCCTTCCAAATGTCAAGCACCTGTTTGCCGGCTGATTGTAGATTACGAAGGG
TTTAACCTCTGCATCATCTTGTTCTGATGCTTTTCTTCGTGTGCTATTGGCAGTCCTCACCCCTGAGCTCCGGACGGCGGTGGAAGAATTCCTGCAGGAGCACAAGGTCGTGCTCTTCAT
GAAGGGCAACCGGCAGTTCCCACAGTGCGGCTTTTCGAACACCTGTGTCCAGATTCTCAACATGGTTCAAGTCCCATATGAGACCGTCAACATTTTAGAGAACGAAACTCTCCGAGCGGG
CATGAAGGAGTATTCGTCCTGGCCCACCTTCCCGCAAATCTACATCGATGGGGAGTTCATCGGGGGATGCGACATTGCCATTG
GTGAGCTTCAAAGTCGCTTCAAGGAGTTTGCATATTT
GGTGCCAGATCTTATCCAGGCTTCTCTTCACCAAAGGTTAGAAGGTGCCAGTAGCCTCTTTTTATTGAATGTAACTGTGAAGGATGTACTTTCAAATGATGAAGCTGCAGATGATGAAGC
TCAGTGGACCGAGCTCTTGCTGCTTGTCTGAATGGGGATCGAGGTTCCTTTCCAGCTCAATCATCACTTTTATGCTTTCCCTTCACGGATTGTGACCCTAAATCAAAGAACTTGGACCTT
GCGGTCCTATAAGAAGAAAGCTGATCCATAGCCAAGCGACCGCGTGGTGCTATTTTTCCTATAATTTCTGCCTAAACAAAAGATTAATACTTCCTTCTGTTTTTGGTGTCTCTTTGCGAC
ATGCTATCGTATTGCCTCCTTATCGTCAGTTTAGCCATCGATTAGAGTTTCAATTTTGATCATTCATTGCTCCACCTCGACTGCAGAACTTTACCAGAGCGGCGAGTTGAAGGAGCTTGT
CGAGAAGGCCCTCGTCTCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCATGGGCAAAACTCAGACTGTGAGGCGAACTGCACACTCAGGATGCCGTGCGTCTGCAGGGGCCAGTTCTGGTGGGGGTTCAGTCCTCACCCCTGAGCTCCGGACGGCGGTG
GAAGAATTCCTGCAGGAGCACAAGGTCGTGCTCTTCATGAAGGGCAACCGGCAGTTCCCACAGTGCGGCTTTTCGAACACCTGTGTCCAGATTCTCAACATGGTTCAAGTCCCATATGAG
ACCGTCAACATTTTAGAGAACGAAACTCTCCGAGCGGGCATGAAGGAGTATTCGTCCTGGCCCACCTTCCCGCAAATCTACATCGATGGGGAGTTCATCGGGGGATGCGACATTGCCATT
G
AACTTTACCAGAGCGGCGAGTTGAAGGAGCTTGTCGAGAAGGCCCTCGTCTCATAG

Retrieve as FASTA