Entry information : KflGrxS03 (Kfl_001440310)
Entry ID 13994
Creation 2016-10-25 (Christophe Dunand)
Last sequence changes 2016-10-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-25 (Christophe Dunand)
Peroxidase information: KflGrxS03 (Kfl_001440310)
Name (synonym) KflGrxS03 (Kfl_001440310)
Class CGFS Grx    [Orthogroup: GrxS001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGrxS03
start..stop
S start..stop
MpGrxS04 397 2e-136 17..372 20..390
MpGrxS04 288 1e-93 111..371 269..496
MpalGrxS04 394 2e-135 17..372 20..390
MpalGrxS04 293 9e-96 90..372 244..497
PpaGrxS01 380 4e-132 25..372 26..350
PpaGrxS03 379 1e-131 25..372 31..356
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150478..150723 246 N° 2 151460..152335 876  
join(150478..150723,151460..152335)


exon

Literature and cross-references KflGrxS03 (Kfl_001440310)
Protein sequence: KflGrxS03 (Kfl_001440310)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373
PWM (Da):   %s   40057.31  
PI (pH):   %s   4.59
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTDRLVDAADLPAFEQIVSGAPEAVVHFWASWCEPCKHLDNILAQLASENQNAAFVRVEAEEVADVSEKYDVAAVPFFLFFKNGALVDCLEGANPGELSKKVALHLKGTGSANGAISAKSSGSAPATQAPSVKAAPSKDALQAKLTALVKSRPVLLFMKGTPEAPRCGFSKKVVAALKEENVPFGSFDILGDEEVRQGMKEFSNWPTFPQLYVNGELVGGCDIVLEMAQSGELRELLQKEGVTAVVDKATTSETKVTDSEQVQDKSVVEGGKGRLEDRLEALVNSKPVVLFMKGTPENPRCGFSQKVVRALREEGVDFGSFDILSDEEVRQGLKAYSNWPTFPQLYSKGELVGGCDIVLEMHESGELKEALAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGACCGCTTAGTGGACGCTGCGGATCTCCCCGCTTTCGAGCAAATTGTCAGCGGGGCACCTGAGGCGGTGGTGCACTTCTGGGCTTCCTGGTGTGAGCCCTGCAAGCACCTAGAC
AACATTCTCGCACAACTAGCGTCTGAGAATCAGAACGCAGCATTCGTGCGGGTGGAAGCGGAGGAGGTCGCAGACGTGTCGGAGAAGTATGACGTCGCTGCTGTTCCCTTCTTCCTTTTC
TTCAAG
GTGAGTTGGGTGGCTAGGTAGTGTCAGGTGATGAAGAATTGGTGCAAAAAGCAGCTCCTTAATATTGATGAAAAGACTCTCTTTCTTGAAAGCTTTTGAAATTCATCTCACGAG
TACAACTTCTTGGGTTTTGCAGCTACTTTGTATTGCATGTTTTGCTCATGAATAATAGCAAGCTAGCACTGCGCCGGGCATGAGAAGTGTCTTGTTAAGGTTCCATGGATTGGGACAGCT
TCACATTTAGTGGAAGAAATAAGCTCCTTTCAAATTGGCAATTAAACCGTAGGTTCAGGTGCTTGATGAGGTGACAAGTTTGACGTGCTTTCACTGAGCAATTTGTCGATTTGGCAGGAG
GTGGGTCAGCGCATATTGGTGACAAACTGGGGGGGCTAACTTATGTACAGAGAAGGTGTTTATTGCTTGCTGCAATTCTCTGACGGTTGAGGACCACTTCAGGGCCTGTAGTTACTGAGT
TCTTTCTTGTTGGCATCAGTGTCCGTCCGCATCAGGTCCTCTTTCTCTTTCAGCGATGAAACTAATCAGTTTTGAAAATTGTTCTAGTGCTGCAATCCTTCTTCATCATTGCAATCAATC
CTCAGTATTGCAATCCATCCTTATCAATCTGATTAGTGTATCATTACTGCAATGTTTCATGACTGCCATCCATCTTTATCATGATCAATGTCCAGCGAGCTTCCCCACTGATTGGGGCGT
ATTCACTCTTCCTCTTGTGCAGAATGGTGCTCTGGTGGACTGCTTGGAAGGCGCCAACCCTGGGGAGCTCAGCAAAAAGGTCGCGCTGCACCTGAAGGGAACAGGATCCGCAAATGGCGC
AATTTCGGCTAAGTCTAGTGGTTCCGCCCCCGCAACCCAGGCCCCCAGCGTCAAGGCCGCCCCTTCTAAAGATGCCCTGCAAGCAAAGCTCACCGCCCTAGTTAAGTCTCGGCCGGTTCT
CTTGTTCATGAAAGGCACTCCGGAAGCCCCCCGCTGCGGGTTCAGTAAAAAAGTGGTGGCGGCATTGAAGGAGGAGAACGTCCCGTTTGGCTCGTTTGACATTTTGGGAGACGAGGAGGT
GCGCCAGGGGATGAAGGAGTTCTCGAACTGGCCGACGTTTCCGCAGCTTTATGTGAACGGGGAGCTCGTGGGGGGGTGCGACATTGTACTGGAAATGGCCCAAAGTGGGGAGTTACGAGA
GCTGCTTCAGAAAGAGGGGGTGACGGCGGTCGTCGATAAGGCGACTACGAGTGAAACGAAAGTGACGGACTCGGAGCAGGTGCAGGATAAGAGCGTGGTCGAGGGAGGGAAGGGAAGGCT
GGAGGACCGGTTAGAGGCGCTGGTTAACTCCAAACCCGTGGTCCTCTTTATGAAGGGCACGCCGGAGAATCCCCGGTGCGGGTTCAGTCAGAAGGTGGTCAGGGCGTTGCGGGAGGAGGG
GGTAGACTTCGGGAGCTTTGACATTCTGAGTGACGAGGAGGTGCGGCAGGGCCTCAAGGCGTACTCGAACTGGCCGACGTTCCCGCAGCTGTACAGCAAGGGCGAGCTTGTTGGGGGGTG
CGACATCGTTCTCGAGATGCACGAGAGCGGGGAACTGAAAGAAGCTCTAGCTGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGACCGCTTAGTGGACGCTGCGGATCTCCCCGCTTTCGAGCAAATTGTCAGCGGGGCACCTGAGGCGGTGGTGCACTTCTGGGCTTCCTGGTGTGAGCCCTGCAAGCACCTAGAC
AACATTCTCGCACAACTAGCGTCTGAGAATCAGAACGCAGCATTCGTGCGGGTGGAAGCGGAGGAGGTCGCAGACGTGTCGGAGAAGTATGACGTCGCTGCTGTTCCCTTCTTCCTTTTC
TTCAAG
AATGGTGCTCTGGTGGACTGCTTGGAAGGCGCCAACCCTGGGGAGCTCAGCAAAAAGGTCGCGCTGCACCTGAAGGGAACAGGATCCGCAAATGGCGCAATTTCGGCTAAGTCT
AGTGGTTCCGCCCCCGCAACCCAGGCCCCCAGCGTCAAGGCCGCCCCTTCTAAAGATGCCCTGCAAGCAAAGCTCACCGCCCTAGTTAAGTCTCGGCCGGTTCTCTTGTTCATGAAAGGC
ACTCCGGAAGCCCCCCGCTGCGGGTTCAGTAAAAAAGTGGTGGCGGCATTGAAGGAGGAGAACGTCCCGTTTGGCTCGTTTGACATTTTGGGAGACGAGGAGGTGCGCCAGGGGATGAAG
GAGTTCTCGAACTGGCCGACGTTTCCGCAGCTTTATGTGAACGGGGAGCTCGTGGGGGGGTGCGACATTGTACTGGAAATGGCCCAAAGTGGGGAGTTACGAGAGCTGCTTCAGAAAGAG
GGGGTGACGGCGGTCGTCGATAAGGCGACTACGAGTGAAACGAAAGTGACGGACTCGGAGCAGGTGCAGGATAAGAGCGTGGTCGAGGGAGGGAAGGGAAGGCTGGAGGACCGGTTAGAG
GCGCTGGTTAACTCCAAACCCGTGGTCCTCTTTATGAAGGGCACGCCGGAGAATCCCCGGTGCGGGTTCAGTCAGAAGGTGGTCAGGGCGTTGCGGGAGGAGGGGGTAGACTTCGGGAGC
TTTGACATTCTGAGTGACGAGGAGGTGCGGCAGGGCCTCAAGGCGTACTCGAACTGGCCGACGTTCCCGCAGCTGTACAGCAAGGGCGAGCTTGTTGGGGGGTGCGACATCGTTCTCGAG
ATGCACGAGAGCGGGGAACTGAAAGAAGCTCTAGCTGCCTAG

Retrieve as FASTA