Entry information : AtPNC01 (AT2G02850/AtPNC/ARPN)
Entry ID 14052
Creation 2016-10-26 (Christophe Dunand)
Last sequence changes 2016-10-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-26 (Christophe Dunand)
Peroxidase information: AtPNC01 (AT2G02850/AtPNC/ARPN)
Name (synonym) AtPNC01 (AT2G02850/AtPNC/ARPN)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPNC01
start..stop
S start..stop
ThasPNC01 174 5e-58 1..128 1..128
HaPNC16 137 2e-43 1..128 1..125
HaPNC11 135 2e-42 1..128 1..125
HaPNC01 132 1e-41 1..128 1..125
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 275..464 190 N° 2 1166..1365 200  
join(275..464,1166..1365)


exon

Literature and cross-references AtPNC01 (AT2G02850/AtPNC/ARPN)
Cluster/Prediction ref. Genebank:   814816
Omic ref. AtProteome:   At2g02850 ATTED-II:   At2g02850 e-FP Browser:   At2g02850 TAIR:   At2g02850
Protein sequence: AtPNC01 (AT2G02850/AtPNC/ARPN)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   129 (96)
PWM (Da):   %s   13929.95 (10485.1)  
PI (pH):   %s   9.94 (9.56) Peptide Signal:   %s   cut: 34 range:34-129
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGSASWSARAIVTLMAVSVLLLQADYVQAATYTVGDSGIWTFNAVGWPKGKHFRAGDVLVFNYNPRMHNVVKVDSGSYNNCKTPTGAKPYTSGKDRITLSKGQNFFICNFPNHCESDMKIAVTAV

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGGGAAGAGGCAGTGCATCATGGTCGGCTCGAGCCATAGTGACTCTCATGGCTGTGTCAGTGTTGTTGCTTCAAGCTGACTACGTTCAAGCTGCAACGTACACGGTCGGTGAC
TCTGGTATCTGGACCTTTAACGCTGTGGGTTGGCCTAAAGGCAAACACTTTAGAGCCGGCGACGTTCTTG
GTATATACTTCACATCCTTTTAATCAAGCTTCAGTAATTATTATACTATC
TTGTTACACTTAAACCACAAGCAGTTAAGCTTTCTAATCTTCATATCCACTAGGGATGTATCCATATCATGGCTGCTTCTAAGTATGGGCAAGATGTGCTTTTGTATAAAGCACACGACA
AATAAAAAACTTCCTATAGTTTAAAGGTTACAAATATGATTGATAAATGTTTTGCATACACAGTTTAAATAGTGTATATCTTTTACATGATTGAGCCTGTGATATATTTTACTATATTAT
AGATATGTATGTATACATCTTCCTTCTCCAAAATTTTTTTTCTAGTTTCGATTATTCACAAACGCTGATTTATGTGTATAGCAAAAATTCATGTGCGTTTAAATTTAACAAAAAATATTT
TAAAATATCATAAATAGTACCACTAACCTAATTTTTAATTTATTTTGGTATACTTGAGTGATGAATTAAAATTGTTTTCGCATGAAGAAATATCTCAACCAACGTTATAGTATGTAGATT
TATGAAATTCCTAAACAGTTCCAGCTACTTTATAATCTGAGTGTCAATATATGGAATCAATTAAGAGTGGTCGAGTAATCAATTATATGATTAACTAATTTAACGTTAGACCAAAAAAAA
AAAATTATATGATTAACTTAAAATTTTATATTTTCCAAAACTTTGGTGCAGTGTTTAACTATAATCCGAGGATGCACAACGTAGTGAAGGTAGATAGCGGAAGTTACAACAACTGCAAAA
CACCGACAGGGGCAAAACCTTACACTTCAGGCAAAGATCGTATAACTTTGTCTAAAGGACAAAACTTTTTCATCTGCAATTTTCCAAACCATTGCGAAAGCGATATGAAAATCGCAGTCA
CCGCGGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGGGAAGAGGCAGTGCATCATGGTCGGCTCGAGCCATAGTGACTCTCATGGCTGTGTCAGTGTTGTTGCTTCAAGCTGACTACGTTCAAGCTGCAACGTACACGGTCGGTGAC
TCTGGTATCTGGACCTTTAACGCTGTGGGTTGGCCTAAAGGCAAACACTTTAGAGCCGGCGACGTTCTTG
TGTTTAACTATAATCCGAGGATGCACAACGTAGTGAAGGTAGATAGCGGA
AGTTACAACAACTGCAAAACACCGACAGGGGCAAAACCTTACACTTCAGGCAAAGATCGTATAACTTTGTCTAAAGGACAAAACTTTTTCATCTGCAATTTTCCAAACCATTGCGAAAGC
GATATGAAAATCGCAGTCACCGCGGTTTGA

Retrieve as FASTA