Entry information : PpaSTC01 (Pp3c3_25110)
Entry ID 14076
Creation 2016-10-26 (Christophe Dunand)
Last sequence changes 2016-10-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-26 (Christophe Dunand)
Peroxidase information: PpaSTC01 (Pp3c3_25110)
Name (synonym) PpaSTC01 (Pp3c3_25110)
Class Stellacyanin    [Orthogroup: STC004]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaSTC01
start..stop
S start..stop
PpaENODL20 101 3e-27 1..128 1..127
PpaENODL22 99 7e-26 1..132 1..131
AtSTC03 94 1e-24 9..135 8..131
PpaENODL07 94 2e-24 11..141 15..142
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 581..773 193 N° 2 907..1208 302  
join(581..773,907..1208)


exon

Literature and cross-references PpaSTC01 (Pp3c3_25110)
Protein sequence: PpaSTC01 (Pp3c3_25110)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166 (140)
PWM (Da):   %s   16886.44 (14307.1) Transmb domain:   %s   i7-26o140-162i (o115-137i)
PI (pH):   %s   7.02 (6.50) Peptide Signal:   %s   cut: 26 range:26-165
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQGRCSAVLVVSLLLVSSAAVVHGVDHNVGGTTKWIKPDGSTVPENFYQKWASEEKFTAGDNLVFVYNPAGHSVLEVSATDYAACSTTTPIKRYATGNDIISVPAGPSYWICGIPSHCPAGQKFNITAAAGSSGPSSSVGTGNAVSILHVVAALAVALIASMSM*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACAGGGAAGATGCAGTGCAGTGCTGGTTGTTTCGCTCCTTCTGGTTAGCTCTGCCGCCGTGGTGCACGGAGTCGATCACAATGTAGGAGGGACAACCAAGTGGATCAAGCCGGAT
GGTTCCACAGTCCCAGAAAACTTCTATCAGAAGTGGGCCAGTGAAGAGAAATTCACAGCAGGCGATAATCTGG
GTTTTTAAGCTCAACCCTGATTTATCTAGTTTAACATGTAGAGCAAA
TTTCCTTAGTAGCTGGTCTGTTGACAGTTCAGTAGCGTCTTACACAATTAATATGGCGTGCTAAAAATTGTATTATGGATTGGCAGTTTTCGTCTACAACCCAGCTGGGCACAGTGTGCT
AGAAGTGAGTGCGACTGACTACGCCGCCTGCTCGACCACCACTCCAATCAAGAGATATGCAACCGGAAACGACATCATCTCTGTCCCTGCTGGACCGAGCTACTGGATCTGCGGAATTCC
ATCACATTGCCCCGCTGGTCAGAAGTTTAATATCACCGCCGCTGCTGGTTCTTCTGGTCCTTCTAGTTCTGTTGGTACAGGAAATGCTGTGAGTATTCTTCACGTTGTTGCTGCCTTGGC
AGTGGCCTTGATTGCCTCAATGTCTATG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACAGGGAAGATGCAGTGCAGTGCTGGTTGTTTCGCTCCTTCTGGTTAGCTCTGCCGCCGTGGTGCACGGAGTCGATCACAATGTAGGAGGGACAACCAAGTGGATCAAGCCGGAT
GGTTCCACAGTCCCAGAAAACTTCTATCAGAAGTGGGCCAGTGAAGAGAAATTCACAGCAGGCGATAATCTGG
TTTTCGTCTACAACCCAGCTGGGCACAGTGTGCTAGAAGTGAGTGCG
ACTGACTACGCCGCCTGCTCGACCACCACTCCAATCAAGAGATATGCAACCGGAAACGACATCATCTCTGTCCCTGCTGGACCGAGCTACTGGATCTGCGGAATTCCATCACATTGCCCC
GCTGGTCAGAAGTTTAATATCACCGCCGCTGCTGGTTCTTCTGGTCCTTCTAGTTCTGTTGGTACAGGAAATGCTGTGAGTATTCTTCACGTTGTTGCTGCCTTGGCAGTGGCCTTGATT
GCCTCAATGTCTATG

Retrieve as FASTA