Entry information : KflTDX01 (Kfl_000490350)
Entry ID 14192
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-04 (Christophe Dunand)
Peroxidase information: KflTDX01 (Kfl_000490350)
Name (synonym) KflTDX01 (Kfl_000490350)
Class Thioredoxin Type TDX    [Orthogroup: TDX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflTDX01
start..stop
S start..stop
PpaTDX01 238 2e-74 4..311 1..271
HaTDX01 193 4e-58 143..325 64..244
HaTDX01 51 0.0000002 4..49 1..46
AtTDX01 193 5e-58 143..326 71..254
AtTDX01 51 0.0000002 4..61 2..59
ThasTDX01 182 5e-54 136..312 61..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 omplement254288..254382 254383 N° 2 254656..254713 58 N° 3 255419..255580 162 N° 4 255995..256111 117
N° 5 256683..256823 141 N° 6 257854..257918 65 N° 7 258408..258488 81 N° 8 258846..258933 88
N° 9 259283..259582 300 N° 10 260773..260955 183  
omplement(join(254288..254382,254656..254713,255419..255580,255995..256111,25668 3..256823,257854..257918,258408..258488,258846..258933,259283..259582,260773..26 0955))


exon

Literature and cross-references KflTDX01 (Kfl_000490350)
Protein sequence: KflTDX01 (Kfl_000490350)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   429
PWM (Da):   %s   45962.19  
PI (pH):   %s   4.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGLDAKKVAELKNFISAVDAHPELLAEPRLAFFRTYLESLGAKLPAAAFKTKSVPTPPPQASHMSQASNFSLIVSGIGRWGGGARKSMQLLHYHNAFGEYLDSDVQTSSAASLLRKKQESRLLIILPVACKSTISVQ*KESLGQCISPVTDCIPLRIQGSIFYSFV*TPISSLNRLQS*RQ*PFFDHWNRDVTLFQKTLSKSNARRS*TFVPIASPAQKEEALTQGPEHNFGI*HEAEGTVSGFTLRFQGFGG*SDGNIVIDSAPSRHTAFSKVFDTVAELIIFNLAPSIPLLGMKDRGGPSFQFVRHNLMKSAI*W*TLLVVLTSIVCLLVCADRLITSTDFEIQQALMTI*VQ*LVCLNLRFGASLSRTDFLRVSDLDKPCDFKGWLSNWKSDFLVAQQLLQYTGCPSCEGQLQSSHISKSESSSYTDLRKQIEDHSSYSGDIAWSAQHPILTCRRSPPPLLMTPTMTTTMTTCPPWRTRSLRLQLEPGPIHTPMEPILTLTVLVVITVTITRR*KKRKKRRRRRKRKKKKKRRCWTWETTTRG*LSPTMMSLRR*EIFLAV*ACRACSGTGK*WESGGCYYKDVLINKRIFYGEISSYIGSADWAREERSG*VNLMATFIFQTAEHLVILNHCFKALQT*EPAFAIRLSP*LNSENISNHQSSLPYLILQMGDSSKEISEEDYDAAVASKGKAMEAMAEGKFKLFQATRAAS*YWKYHSWNRNRYVLQFC*KRDSDTLLF*PE*SVSQKKKTRLRPLLSVKQARTLQSRQLLLFLILSRDPLAKLTVIS*SPHVATLRAGGPLQTISIRSIRIFTCFAGDLPTAIEHFTEAILRNPSSAILYANRGRCTARQRLRSYYLRATMSCFML*YGLSRISSWYEGKLQSLIGTISNKRWKLKRKRIDFYQSFDCLV*SSFSMQPGRSSKQIRWGDGKEGGRGGGGRCRQGEELHVL*NKSRPARRRVILVSRMTV*RDPVCTRPQDSPVEIVKPSLRPVAQSSKSKGRF*SAASAFIKAKKPNAAIRDCNAAMKVSEGQHPRVVAYHMCFS*EESWDDLVVAWSKAQMETFVTTTVDKNNHYEQRKCSWAGS*EAKRSRTA*VPATLPFHCLSLSIDQPNTSFPQEQFWINGFWARTGRNRLNHFVGAQVRCPPEDL*SRP*SPGVVPPCLALIAVRS*EINRSGGPMTRIATLRLPDSVASKCNSEPQHI*GSILTKGLDVNCYYCEAESVQILRKYASRPTLNSQYVSISEFNEPRRSKLLSLDKFDPAGRGDPILFQHLLLSFKLVPFRIVSFFGGTNFGVYPFNTVLERILFLLSL*SVSPLVPAQINPDSARPYKWHGLQLPESGASQTQFRASVCIGKHSYRTLNVNCGPADQPRLSPAVQVARRGACVAGSLGGGRQRPARGRPARLRRGDRRVPQDGALHLAVKLCHRFGPSCSLYTCIGSLRDQQVPLIQIAPGGDTFVACVPFLLHFHESHTFGHDPLL*HANSSRGGCLGGS*PQGFLHVEKRTLTLHIPQSLAGFACITGSCYASLQGYALPVFCTQDFHRVSFGCRTSPGHRKLLPLTKNG*RAVNQI*TQVRLVEGHLTNHKPNLVYQHCSGLRP*PALCRSSQRRRRLPTSTGGRSVGPRSERTRRRPKRWPRGRKPRRSEFGLAQGLDAVQIQIPSSCRACKRKAVRKAGFEGRVFRKIVKRP*GSVCDNLFLRANEPLSEPRHSWALVCRLRSVSCALFPPQTGQQGSSIRLNRILRYS*RYVPRRYQNLRPKELRTYFLEGLQISDRDSYHPGSVHTSSKRRRRKRAAAADLPVARAAGLEEGVSAGEREGAFQGPGVHSRT*ASCSR*ASVIGWERTRGRCRFRQEPRRVRKSLSLRCGIAEGRGQSGVGSGARLVMVRPRTLYFESVPFAAASFCASPI*ESGRNVTDRKAR**HEVDRLWGMGCVTSVDGF*LIIVERFRRCVVPWIERVIL*AVRPVL*TGRARSCQTFFPVVKRSVVSHFCYIQSDSPYPPARKGVAG*RRQKENFNPGHLYRDVVRGRGCVCQASEAALGTIKP*NPDPKTLKPEKVDI*TFFFLCRTPS*WQPCRIQRSWQHFPRVSLLHPHFEVRQR*CRLDGTGLWPPL*SC*PYTGNELLSLIKNLFRATLIRRGCISFRSFSASVEVMVLWPW*VC**PSRHVQTSCSILVQ*TAILAHSPSTQATPR*CKFWTSSRGWGWQX

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGGCTCGATGCAAAGAAGGTGGCAGAGCTGAAGAACTTTATATCAGCTGTTGACGCCCATCCTGAATTGCTGGCCGAACCTCGTCTGGCATTCTTCCGCACGTACCTGGAAAGT
TTGGGGGCCAAGCTCCCAGCGGCTGCTTTCAAGACCAAAAGTGTACCCACACCACCACCGCAGGCAAGTCATATGAGTCAAGCCTCGAACTTTTCTTTGATTGTTTCGGGAATTGGGCGA
TGGGGAGGAGGTGCTAGAAAATCAATGCAATTGTTGCATTATCATAATGCTTTTGGAGAATATCTTGATTCTGACGTCCAGACATCATCTGCAGCAAGTCTGTTAAGGAAAAAGCAGGAG
TCAAGATTGCTTATTATCCTTCCGGTGGCATGCAAGTCAACAATAAGTGTCCAGTAGAAGGAAAGCCTCGGACAATGCATTAGTCCTGTAACTGATTGCATCCCTTTACGCATTCAAGGC
AGCATATTTTACAGCTTTGTATGAACCCCAATCAGTAGCCTTAATCGCCTACAATCTTAGAGACAGTGACCTTTCTTCGATCACTGGAACAGAGATGTCACTTTATTCCAGAAAACACTA
TCAAAAAGCAATGCCAGGAGGAGCTGAACATTTGTTCCTATAGCATCACCAGCACAAAAGGAAGAGGCATTGACGCAAGGTCCTGAACATAACTTTGGAATTTGACATGAAGCAGAAGGC
ACAGTTTCAGGCTTTACATTACGTTTTCAAGGGTTTGGTGGCTGAAGCGATGGGAACATCGTCATTGACTCTGCACCCTCCAGACATACCGCTTTCTCAAAGGTTTTTGACACTGTGGCT
GAATTGATCATATTCAATCTTGCGCCTAGCATTCCTTTGCTGGGCATGAAGGACCGAGGAGGACCGTCCTTTCAGTTTGTACGTCACAATTTAATGAAGAGTGCAATATAATGGTGAACA
CTGTTGGTCGTGCTAACATCAATTGTCTGCCTTCTGGTATGTGCTGACAGATTAATCACTTCCACAGACTTTGAGATTCAGCAGGCACTAATGACGATCTAGGTTCAGTAACTGGTCTGC
TTGAACCTCAGATTTGGCGCCAGCCTATCACGGACGGATTTTCTCCGCGTTTCAGATCTTGACAAGCCATGCGACTTCAAAGGCTGGTTATCAAACTGGAAGTCGGACTTTTTAGTTGCT
CAACAGCTTTTGCAATATACTGGTTGCCCCAGTTGCGAAGGCCAGCTTCAGTCTTCACACATCTCGAAATCTGAGTCGTCCTCATACACTGATTTGAGAAAGCAAATTGAGGATCATTCA
AGTTACAGTGGTGACATCGCCTGGTCTGCTCAACACCCGATCCTCACCTGCAGGCGAAGCCCGCCCCCGCTGCTGATGACACCGACGATGACGACGACGATGACGACATGCCCCCCTTGG
AGGACGAGGTCCCTGCGGCTGCAGCTGGAGCCGGGGCCCATTCACACTCCCATGGAGCCCATTCTCACACTCACGGTCCTGGTTGTAATCACGGTCACAATCACGAGGAGGTAGAAGAAG
AGGAAGAAGAGGAGGAGGAGGAGGAAGAGGAAGAAGAAGAAGAAGAGGAGGTGTTGGACCTGGGAGACGACAACGAGGGGGTGATTGAGCCCGACAATGATGAGCCTCAGAAGGTGAGAG
ATTTTTTTGGCAGTCTGAGCGTGTCGTGCTTGCTCAGGAACAGGAAAGTAGTGGGAGAGTGGAGGATGTTATTACAAAGATGTTCTTATCAACAAACGGATATTCTATGGAGAAATTTCC
TCTTATATAGGGTCCGCAGATTGGGCAAGGGAGGAAAGGTCTGGTTAGGTGAATCTAATGGCGACTTTCATTTTCCAAACGGCAGAGCATCTAGTCATTCTGAATCACTGCTTCAAAGCT
TTGCAGACTTGAGAGCCAGCTTTTGCAATCAGGTTATCACCTTAGTTGAACAGTGAGAACATTTCCAATCACCAATCGAGCCTGCCTTACCTGATTCTGCAGATGGGAGATTCATCCAAG
GAGATTTCCGAGGAGGATTACGATGCTGCAGTTGCGTCAAAGGGCAAAGCAATGGAAGCCATGGCCGAGGGTAAGTTCAAATTGTTCCAAGCTACTCGAGCAGCCAGTTGATATTGGAAA
TACCATTCATGGAACAGAAATAGGTATGTTTTGCAATTCTGTTGAAAGAGAGATTCAGACACTTTACTGTTCTAGCCTGAGTAGTCTGTCTCGCAAAAGAAGAAAACCAGATTGCGTCCG
TTGCTTTCTGTCAAGCAGGCTCGTACACTTCAATCTCGGCAGCTGCTTTTATTTCTTATTTTGTCTCGTGATCCTTTGGCGAAGCTGACCGTCATTTCTTAGAGTCCGCACGTGGCCACA
CTAAGAGCTGGCGGCCCTTTGCAGACGATATCCATTCGTTCCATTCGAATCTTCACATGTTTTGCAGGTGATTTGCCGACTGCTATTGAGCACTTCACCGAGGCTATCCTGCGCAACCCG
TCCTCCGCTATCCTGTATGCCAACAGAGGTAGGTGCACCGCCAGACAACGCCTCAGATCTTATTACCTGCGTGCGACAATGTCATGCTTCATGCTCTGATACGGTCTTTCTAGAATCTCG
AGCTGGTACGAAGGCAAACTTCAAAGCCTGATCGGAACTATCTCTAACAAGAGGTGGAAGCTGAAGCGAAAGCGAATCGATTTTTATCAATCATTTGATTGTTTGGTTTAGTCTTCTTTT
TCAATGCAGCCCGGGCGATCGTCCAAGCAGATTAGATGGGGGGATGGGAAGGAAGGGGGAAGAGGGGGGGGGGGGAGGTGCCGTCAAGGGGAGGAATTACATGTGCTGTAAAACAAATCA
CGACCAGCTCGGCGGAGGGTAATTCTGGTCAGCAGAATGACTGTTTAGAGAGACCCTGTCTGTACTAGACCCCAAGATTCTCCTGTAGAAATTGTCAAACCCTCCCTAAGGCCAGTCGCC
CAGTCTTCGAAGAGTAAGGGACGTTTTTAATCTGCAGCAAGCGCTTTCATCAAGGCGAAGAAGCCGAACGCGGCCATCCGAGACTGCAACGCTGCGATGAAGGTGAGCGAAGGGCAGCAC
CCTCGTGTGGTCGCATACCACATGTGCTTTTCCTGAGAGGAATCATGGGATGACCTTGTGGTAGCTTGGAGTAAAGCTCAGATGGAGACGTTTGTTACCACAACCGTCGATAAAAATAAT
CATTATGAACAGCGAAAGTGTTCATGGGCTGGGAGTTGAGAAGCGAAGAGAAGTAGAACTGCGTAAGTCCCAGCCACCTTGCCGTTTCACTGTCTGTCCTTGTCAATCGACCAGCCAAAC
ACAAGCTTTCCACAAGAGCAATTCTGGATAAATGGTTTTTGGGCGCGCACAGGTAGAAACCGTTTGAATCACTTCGTCGGTGCCCAGGTTCGGTGTCCACCAGAAGACCTTTAAAGCCGG
CCGTGAAGTCCTGGAGTCGTTCCTCCTTGCCTTGCCCTGATTGCGGTCAGGTCATGAGAGATCAACAGAAGTGGGGGTCCGATGACCCGAATAGCAACCTTGCGGCTTCCAGATAGTGTG
GCGTCCAAATGCAATTCCGAGCCTCAGCATATTTAGGGAAGCATTCTTACAAAAGGGTTGGATGTCAATTGCTACTATTGTGAAGCGGAGAGCGTTCAAATTCTACGAAAGTACGCCTCC
CGACCCACTTTAAATTCTCAATATGTATCAATTAGTGAATTCAATGAGCCTAGACGCTCAAAGCTGCTCTCATTAGACAAGTTTGATCCTGCAGGAAGAGGTGATCCTATCCTATTCCAG
CATCTTTTATTGAGTTTCAAGCTTGTACCTTTCAGAATTGTCTCTTTTTTTGGTGGAACCAACTTTGGTGTATACCCGTTCAACACTGTTCTTGAAAGAATCTTGTTTTTGCTTTCCTTA
TGAAGCGTAAGCCCCCTAGTCCCCGCGCAGATCAACCCCGACTCAGCCCGGCCGTACAAGTGGCATGGCTTGCAGCTTCCAGAAAGTGGGGCATCCCAAACGCAATTCCGAGCCTCAGTA
TGTATAGGGAAGCATTCTTACAGGACGTTAAACGTCAATTGCGGCCCCGCAGATCAACCCCGACTCAGCCCGGCCGTACAAGTGGCGCGGCGAGGCGCATGCGTTGCTGGGTCACTGGGA
GGAGGCCGCCAAAGACCTGCGCGTGGCCGCCCGGCTCGACTTCGACGAGGAGACAGACGCGTTCCTCAAGACGGTGCGCTGCACTTGGCCGTGAAACTTTGCCACCGTTTCGGCCCTTCC
TGCTCTTTGTATACGTGCATTGGGAGTTTGCGAGACCAGCAGGTGCCTTTGATTCAAATTGCCCCGGGAGGGGATACGTTCGTCGCTTGTGTTCCTTTTCTTCTCCATTTTCATGAGTCG
CACACGTTCGGACACGATCCATTGCTGTGACATGCAAATAGTAGTCGTGGAGGTTGTTTGGGTGGCTCGTAGCCTCAAGGATTCCTTCATGTTGAAAAGAGGACTCTAACTCTACACATT
CCTCAGAGTCTGGCGGGATTCGCATGCATCACAGGTTCGTGTTATGCAAGTCTCCAGGGTTATGCTTTGCCGGTCTTTTGCACTCAGGACTTTCACAGGGTTTCGTTCGGTTGTCGCACG
TCCCCCGGGCACAGGAAGCTTTTGCCCTTGACCAAGAATGGTTAAAGGGCAGTGAACCAGATATAAACCCAGGTTCGCTTGGTAGAAGGGCACTTAACCAACCACAAACCAAACTTGGTT
TATCAACACTGCTCCGGTCTGAGACCATAACCTGCTCTTTGCAGGTCGAGCCAAAGGCGCAGAAGATTGCCGACTTCAACCGGCGGAAGGAGCGTCGGGCCAAGGAGCGAGAGGACAAGA
AGAAGGCCAAAGAGATGGCCAAGAGGAAGAAAGCCGCGCAGGTCTGAGTTCGGCTTAGCCCAAGGTTTGGATGCAGTGCAGATTCAGATACCTTCGTCTTGCCGAGCGTGTAAGAGAAAA
GCTGTTCGGAAGGCAGGTTTTGAAGGCCGAGTATTTCGGAAAATCGTCAAACGGCCTTGAGGGTCTGTATGCGACAACCTCTTTCTGAGAGCGAACGAGCCGTTGTCAGAACCGAGGCAC
TCGTGGGCGCTTGTTTGTCGGTTGCGTTCGGTCTCGTGTGCGCTCTTTCCGCCACAAACCGGTCAACAGGGGTCTTCGATCAGGCTTAACAGGATCCTGAGGTATTCGTAAAGGTACGTC
CCTCGAAGATACCAAAACTTACGTCCCAAAGAGCTACGAACTTACTTTCTTGAAGGCCTCCAAATCTCAGACCGTGACTCGTACCATCCCGGCAGCGTGCATACGAGCAGCAAAAGAAGG
AGGAGGAAGCGCGCGGCGGCGGCGGATTTGCCGGTGGCGCGGGCGGCGGGTTTGGAGGAGGGGGTTTCGGCGGGGGAACGGGAGGGGGCTTTCCAGGGGCCGGGGGTGCACAGCCGGACA
TGAGCAAGCTGTTCAAGGTGAGCCTCCGTGATTGGTTGGGAAAGGACACGTGGCAGATGCAGGTTTCGGCAGGAGCCTCGTAGGGTTCGCAAAAGCTTGTCTTTAAGGTGTGGGATAGCT
GAAGGGAGGGGACAGTCAGGAGTCGGTTCAGGTGCTCGACTTGTAATGGTACGACCACGAACATTGTACTTTGAGAGCGTCCCTTTTGCTGCAGCATCGTTCTGCGCAAGTCCAATTTAA
GAAAGCGGGCGAAATGTTACCGATAGAAAGGCGCGCTGATGACACGAAGTTGATCGACTATGGGGCATGGGTTGCGTTACGAGCGTCGATGGTTTTTAGCTAATAATTGTTGAACGTTTT
CGACGATGCGTCGTCCCCTGGATTGAGCGGGTTATACTATGAGCGGTACGTCCTGTTTTGTAGACCGGCCGTGCGAGATCTTGCCAAACTTTTTTTCCGGTCGTCAAACGTTCCGTTGTC
AGTCACTTCTGCTACATCCAATCAGACTCCCCTTATCCGCCCGCCCGGAAAGGCGTGGCAGGCTAACGTCGACAAAAGGAAAACTTCAATCCCGGTCATCTGTATCGAGACGTCGTGCGT
GGAAGGGGCTGCGTTTGTCAAGCTTCAGAAGCAGCTTTAGGGACAATCAAACCCTAAAATCCTGACCCTAAAACCCTAAAACCCGAAAAAGTGGACATTTAAACTTTCTTTTTCCTTTGC
AGGACCCCGAGCTGATGGCAGCCATGCAGGATCCAGAGGTCATGGCAGCACTTTCCGCGAGTAAGCCTTCTTCACCCTCATTTTGAAGTGCGCCAACGATAGTGTCGCCTAGATGGGACA
GGCCTCTGGCCCCCTTTGTAGAGCTGCTGACCTTACACAGGCAATGAGTTGCTGAGTCTCATCAAGAACCTGTTCCGAGCTACTCTGATTCGCAGGGGTTGCATATCTTTCCGCTCTTTT
TCCGCGTCTGTCGAGGTGATGGTTCTTTGGCCTTGGTAGGTGTGTTGATGACCCTCCAGGCACGTGCAAACTTCGTGTTCCATTCTTGTACAGTGAACAGCGATCCTAGCTCATTCGCCA
AGTACGCAAGCAACCCCAAGGTGATGCAAGTTCTGGACAAGCTCAAGGGGATGGGGTTGGCAGGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGGCTCGATGCAAAGAAGGTGGCAGAGCTGAAGAACTTTATATCAGCTGTTGACGCCCATCCTGAATTGCTGGCCGAACCTCGTCTGGCATTCTTCCGCACGTACCTGGAAAGT
TTGGGGGCCAAGCTCCCAGCGGCTGCTTTCAAGACCAAAAGTGTACCCACACCACCACCGCAGGCAAGTCATATGAGTCAAGCCTCGAACTTTTCTTTGATTGTTTCGGGAATTGGGCGA
TGGGGAGGAGGTGCTAGAAAATCAATGCAATTGTTGCATTATCATAATGCTTTTGGAGAATATCTTGATTCTGACGTCCAGACATCATCTGCAGCAAGTCTGTTAAGGAAAAAGCAGGAG
TCAAGATTGCTTATTATCCTTCCGGTGGCATGCAAGTCAACAATAAGTGTCCAGTAGAAGGAAAGCCTCGGACAATGCATTAGTCCTGTAACTGATTGCATCCCTTTACGCATTCAAGGC
AGCATATTTTACAGCTTTGTATGAACCCCAATCAGTAGCCTTAATCGCCTACAATCTTAGAGACAGTGACCTTTCTTCGATCACTGGAACAGAGATGTCACTTTATTCCAGAAAACACTA
TCAAAAAGCAATGCCAGGAGGAGCTGAACATTTGTTCCTATAGCATCACCAGCACAAAAGGAAGAGGCATTGACGCAAGGTCCTGAACATAACTTTGGAATTTGACATGAAGCAGAAGGC
ACAGTTTCAGGCTTTACATTACGTTTTCAAGGGTTTGGTGGCTGAAGCGATGGGAACATCGTCATTGACTCTGCACCCTCCAGACATACCGCTTTCTCAAAGGTTTTTGACACTGTGGCT
GAATTGATCATATTCAATCTTGCGCCTAGCATTCCTTTGCTGGGCATGAAGGACCGAGGAGGACCGTCCTTTCAGTTTGTACGTCACAATTTAATGAAGAGTGCAATATAATGGTGAACA
CTGTTGGTCGTGCTAACATCAATTGTCTGCCTTCTGGTATGTGCTGACAGATTAATCACTTCCACAGACTTTGAGATTCAGCAGGCACTAATGACGATCTAGGTTCAGTAACTGGTCTGC
TTGAACCTCAGATTTGGCGCCAGCCTATCACGGACGGATTTTCTCCGCGTTTCAGATCTTGACAAGCCATGCGACTTCAAAGGCTGGTTATCAAACTGGAAGTCGGACTTTTTAGTTGCT
CAACAGCTTTTGCAATATACTGGTTGCCCCAGTTGCGAAGGCCAGCTTCAGTCTTCACACATCTCGAAATCTGAGTCGTCCTCATACACTGATTTGAGAAAGCAAATTGAGGATCATTCA
AGTTACAGTGGTGACATCGCCTGGTCTGCTCAACACCCGATCCTCACCTGCAGGCGAAGCCCGCCCCCGCTGCTGATGACACCGACGATGACGACGACGATGACGACATGCCCCCCTTGG
AGGACGAGGTCCCTGCGGCTGCAGCTGGAGCCGGGGCCCATTCACACTCCCATGGAGCCCATTCTCACACTCACGGTCCTGGTTGTAATCACGGTCACAATCACGAGGAGGTAGAAGAAG
AGGAAGAAGAGGAGGAGGAGGAGGAAGAGGAAGAAGAAGAAGAAGAGGAGGTGTTGGACCTGGGAGACGACAACGAGGGGGTGATTGAGCCCGACAATGATGAGCCTCAGAAGGTGAGAG
ATTTTTTTGGCAGTCTGAGCGTGTCGTGCTTGCTCAGGAACAGGAAAGTAGTGGGAGAGTGGAGGATGTTATTACAAAGATGTTCTTATCAACAAACGGATATTCTATGGAGAAATTTCC
TCTTATATAGGGTCCGCAGATTGGGCAAGGGAGGAAAGGTCTGGTTAGGTGAATCTAATGGCGACTTTCATTTTCCAAACGGCAGAGCATCTAGTCATTCTGAATCACTGCTTCAAAGCT
TTGCAGACTTGAGAGCCAGCTTTTGCAATCAGGTTATCACCTTAGTTGAACAGTGAGAACATTTCCAATCACCAATCGAGCCTGCCTTACCTGATTCTGCAGATGGGAGATTCATCCAAG
GAGATTTCCGAGGAGGATTACGATGCTGCAGTTGCGTCAAAGGGCAAAGCAATGGAAGCCATGGCCGAGGGTAAGTTCAAATTGTTCCAAGCTACTCGAGCAGCCAGTTGATATTGGAAA
TACCATTCATGGAACAGAAATAGGTATGTTTTGCAATTCTGTTGAAAGAGAGATTCAGACACTTTACTGTTCTAGCCTGAGTAGTCTGTCTCGCAAAAGAAGAAAACCAGATTGCGTCCG
TTGCTTTCTGTCAAGCAGGCTCGTACACTTCAATCTCGGCAGCTGCTTTTATTTCTTATTTTGTCTCGTGATCCTTTGGCGAAGCTGACCGTCATTTCTTAGAGTCCGCACGTGGCCACA
CTAAGAGCTGGCGGCCCTTTGCAGACGATATCCATTCGTTCCATTCGAATCTTCACATGTTTTGCAGGTGATTTGCCGACTGCTATTGAGCACTTCACCGAGGCTATCCTGCGCAACCCG
TCCTCCGCTATCCTGTATGCCAACAGAGGTAGGTGCACCGCCAGACAACGCCTCAGATCTTATTACCTGCGTGCGACAATGTCATGCTTCATGCTCTGATACGGTCTTTCTAGAATCTCG
AGCTGGTACGAAGGCAAACTTCAAAGCCTGATCGGAACTATCTCTAACAAGAGGTGGAAGCTGAAGCGAAAGCGAATCGATTTTTATCAATCATTTGATTGTTTGGTTTAGTCTTCTTTT
TCAATGCAGCCCGGGCGATCGTCCAAGCAGATTAGATGGGGGGATGGGAAGGAAGGGGGAAGAGGGGGGGGGGGGAGGTGCCGTCAAGGGGAGGAATTACATGTGCTGTAAAACAAATCA
CGACCAGCTCGGCGGAGGGTAATTCTGGTCAGCAGAATGACTGTTTAGAGAGACCCTGTCTGTACTAGACCCCAAGATTCTCCTGTAGAAATTGTCAAACCCTCCCTAAGGCCAGTCGCC
CAGTCTTCGAAGAGTAAGGGACGTTTTTAATCTGCAGCAAGCGCTTTCATCAAGGCGAAGAAGCCGAACGCGGCCATCCGAGACTGCAACGCTGCGATGAAGGTGAGCGAAGGGCAGCAC
CCTCGTGTGGTCGCATACCACATGTGCTTTTCCTGAGAGGAATCATGGGATGACCTTGTGGTAGCTTGGAGTAAAGCTCAGATGGAGACGTTTGTTACCACAACCGTCGATAAAAATAAT
CATTATGAACAGCGAAAGTGTTCATGGGCTGGGAGTTGAGAAGCGAAGAGAAGTAGAACTGCGTAAGTCCCAGCCACCTTGCCGTTTCACTGTCTGTCCTTGTCAATCGACCAGCCAAAC
ACAAGCTTTCCACAAGAGCAATTCTGGATAAATGGTTTTTGGGCGCGCACAGGTAGAAACCGTTTGAATCACTTCGTCGGTGCCCAGGTTCGGTGTCCACCAGAAGACCTTTAAAGCCGG
CCGTGAAGTCCTGGAGTCGTTCCTCCTTGCCTTGCCCTGATTGCGGTCAGGTCATGAGAGATCAACAGAAGTGGGGGTCCGATGACCCGAATAGCAACCTTGCGGCTTCCAGATAGTGTG
GCGTCCAAATGCAATTCCGAGCCTCAGCATATTTAGGGAAGCATTCTTACAAAAGGGTTGGATGTCAATTGCTACTATTGTGAAGCGGAGAGCGTTCAAATTCTACGAAAGTACGCCTCC
CGACCCACTTTAAATTCTCAATATGTATCAATTAGTGAATTCAATGAGCCTAGACGCTCAAAGCTGCTCTCATTAGACAAGTTTGATCCTGCAGGAAGAGGTGATCCTATCCTATTCCAG
CATCTTTTATTGAGTTTCAAGCTTGTACCTTTCAGAATTGTCTCTTTTTTTGGTGGAACCAACTTTGGTGTATACCCGTTCAACACTGTTCTTGAAAGAATCTTGTTTTTGCTTTCCTTA
TGAAGCGTAAGCCCCCTAGTCCCCGCGCAGATCAACCCCGACTCAGCCCGGCCGTACAAGTGGCATGGCTTGCAGCTTCCAGAAAGTGGGGCATCCCAAACGCAATTCCGAGCCTCAGTA
TGTATAGGGAAGCATTCTTACAGGACGTTAAACGTCAATTGCGGCCCCGCAGATCAACCCCGACTCAGCCCGGCCGTACAAGTGGCGCGGCGAGGCGCATGCGTTGCTGGGTCACTGGGA
GGAGGCCGCCAAAGACCTGCGCGTGGCCGCCCGGCTCGACTTCGACGAGGAGACAGACGCGTTCCTCAAGACGGTGCGCTGCACTTGGCCGTGAAACTTTGCCACCGTTTCGGCCCTTCC
TGCTCTTTGTATACGTGCATTGGGAGTTTGCGAGACCAGCAGGTGCCTTTGATTCAAATTGCCCCGGGAGGGGATACGTTCGTCGCTTGTGTTCCTTTTCTTCTCCATTTTCATGAGTCG
CACACGTTCGGACACGATCCATTGCTGTGACATGCAAATAGTAGTCGTGGAGGTTGTTTGGGTGGCTCGTAGCCTCAAGGATTCCTTCATGTTGAAAAGAGGACTCTAACTCTACACATT
CCTCAGAGTCTGGCGGGATTCGCATGCATCACAGGTTCGTGTTATGCAAGTCTCCAGGGTTATGCTTTGCCGGTCTTTTGCACTCAGGACTTTCACAGGGTTTCGTTCGGTTGTCGCACG
TCCCCCGGGCACAGGAAGCTTTTGCCCTTGACCAAGAATGGTTAAAGGGCAGTGAACCAGATATAAACCCAGGTTCGCTTGGTAGAAGGGCACTTAACCAACCACAAACCAAACTTGGTT
TATCAACACTGCTCCGGTCTGAGACCATAACCTGCTCTTTGCAGGTCGAGCCAAAGGCGCAGAAGATTGCCGACTTCAACCGGCGGAAGGAGCGTCGGGCCAAGGAGCGAGAGGACAAGA
AGAAGGCCAAAGAGATGGCCAAGAGGAAGAAAGCCGCGCAGGTCTGAGTTCGGCTTAGCCCAAGGTTTGGATGCAGTGCAGATTCAGATACCTTCGTCTTGCCGAGCGTGTAAGAGAAAA
GCTGTTCGGAAGGCAGGTTTTGAAGGCCGAGTATTTCGGAAAATCGTCAAACGGCCTTGAGGGTCTGTATGCGACAACCTCTTTCTGAGAGCGAACGAGCCGTTGTCAGAACCGAGGCAC
TCGTGGGCGCTTGTTTGTCGGTTGCGTTCGGTCTCGTGTGCGCTCTTTCCGCCACAAACCGGTCAACAGGGGTCTTCGATCAGGCTTAACAGGATCCTGAGGTATTCGTAAAGGTACGTC
CCTCGAAGATACCAAAACTTACGTCCCAAAGAGCTACGAACTTACTTTCTTGAAGGCCTCCAAATCTCAGACCGTGACTCGTACCATCCCGGCAGCGTGCATACGAGCAGCAAAAGAAGG
AGGAGGAAGCGCGCGGCGGCGGCGGATTTGCCGGTGGCGCGGGCGGCGGGTTTGGAGGAGGGGGTTTCGGCGGGGGAACGGGAGGGGGCTTTCCAGGGGCCGGGGGTGCACAGCCGGACA
TGAGCAAGCTGTTCAAGGTGAGCCTCCGTGATTGGTTGGGAAAGGACACGTGGCAGATGCAGGTTTCGGCAGGAGCCTCGTAGGGTTCGCAAAAGCTTGTCTTTAAGGTGTGGGATAGCT
GAAGGGAGGGGACAGTCAGGAGTCGGTTCAGGTGCTCGACTTGTAATGGTACGACCACGAACATTGTACTTTGAGAGCGTCCCTTTTGCTGCAGCATCGTTCTGCGCAAGTCCAATTTAA
GAAAGCGGGCGAAATGTTACCGATAGAAAGGCGCGCTGATGACACGAAGTTGATCGACTATGGGGCATGGGTTGCGTTACGAGCGTCGATGGTTTTTAGCTAATAATTGTTGAACGTTTT
CGACGATGCGTCGTCCCCTGGATTGAGCGGGTTATACTATGAGCGGTACGTCCTGTTTTGTAGACCGGCCGTGCGAGATCTTGCCAAACTTTTTTTCCGGTCGTCAAACGTTCCGTTGTC
AGTCACTTCTGCTACATCCAATCAGACTCCCCTTATCCGCCCGCCCGGAAAGGCGTGGCAGGCTAACGTCGACAAAAGGAAAACTTCAATCCCGGTCATCTGTATCGAGACGTCGTGCGT
GGAAGGGGCTGCGTTTGTCAAGCTTCAGAAGCAGCTTTAGGGACAATCAAACCCTAAAATCCTGACCCTAAAACCCTAAAACCCGAAAAAGTGGACATTTAAACTTTCTTTTTCCTTTGC
AGGACCCCGAGCTGATGGCAGCCATGCAGGATCCAGAGGTCATGGCAGCACTTTCCGCGAGTAAGCCTTCTTCACCCTCATTTTGAAGTGCGCCAACGATAGTGTCGCCTAGATGGGACA
GGCCTCTGGCCCCCTTTGTAGAGCTGCTGACCTTACACAGGCAATGAGTTGCTGAGTCTCATCAAGAACCTGTTCCGAGCTACTCTGATTCGCAGGGGTTGCATATCTTTCCGCTCTTTT
TCCGCGTCTGTCGAGGTGATGGTTCTTTGGCCTTGGTAGGTGTGTTGATGACCCTCCAGGCACGTGCAAACTTCGTGTTCCATTCTTGTACAGTGAACAGCGATCCTAGCTCATTCGCCA
AGTACGCAAGCAACCCCAAGGTGATGCAAGTTCTGGACAAGCTCAAGGGGATGGGGTTGGCAGGGTAG

Retrieve as FASTA