Entry information : AtTrxF01(AT3G02730/ATF1)
Entry ID 14206
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2019-01-30 (Christophe Dunand)
Peroxidase information: AtTrxF01(AT3G02730/ATF1)
Name AtTrxF01(AT3G02730/ATF1)
Class Thioredoxin Type F    [Orthogroup: TrxF001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtTrxF01
start..stop
S start..stop
AtTrxF02 281 1e-98 1..175 1..185
ThasTrxF01 255 3e-88 1..175 1..180
ThasTrxF02 246 1e-84 1..175 1..179
HaTrxH03 175 6e-56 74..175 144..245
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 103..395 293 N° 2 706..805 100 N° 3 981..1124 144  
join(103..395,706..805,981..1124)


exon

Literature and cross-references AtTrxF01(AT3G02730/ATF1)
Cluster/Prediction ref. Genebank:   821260
Omic ref. AtProteome:   At3g02730 ATTED-II:   At3g02730 e-FP Browser:   At3g02730 TAIR:   At3g02730
Protein sequence: AtTrxF01(AT3G02730/ATF1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   178
PWM (Da):   %s   19256.1  
PI (pH):   %s   9.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPLSLRLSPSPTALSPTTGGFGPSRKQCRIPYSGVPTTKIGFCSLDSRKRGDSSVVRCSLETVNVSVGQVTEVDKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSAASG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCTTTCTCTCCGTCTTTCTCCTTCGCCGACGGCTTTATCTCCGACTACCGGAGGATTTGGTCCATCGAGGAAACAGTGCCGGATTCCTTACTCCGGCGTCCCGACGACGAAGATT
GGTTTCTGTTCTTTGGATTCTAGGAAAAGAGGAGATTCCTCTGTTGTTAGGTGTAGCTTAGAAACCGTTAATGTCAGTGTTGGTCAGGTGACGGAGGTCGATAAGGACACGTTCTGGCCC
ATCGTTAAAGCCGCCGGTGAAAAGCTTGTCGTACTTGACATGTACACTCAATG
GTACCTACTATCTCTTCTATGCCTCTCTCTGCTTTGAAATTTTTACCATTCGACATCTCTGATTGTA
TATAGCGGAATCGATGAAATCAATGGCGTTGCGATGTCGAATGCTTAGATTACCAATTGATTTGAATTTTGATACTAATCAAAGTTTCCGTGGCTTTCAACTAAGATTGAAAAATCTTCT
CAGTTAGATTCTTCTGCAGATGTGGTTCATTTAGATTCCATAGTGAATGTTTTGGTTTTGATGTTGGTAGTCTTTAAAGAGAGTTTCAATTCAAGATGTTCTATTCTTGGATACCTTATG
CAGGTGTGGTCCATGTAAAGTGATTGCCCCTAAATACAAAGCTTTATCAGAGAAGTACGACGACGTTGTGTTTCTAAAGCTTGACTGCAATCCAGATAACCGGGTCTGAGTTCTGCTCTT
TTATCTCTCTTCTTTTGGTAACTCGGTTTTCCTAAACCATATATCAATTGAACCATAGCTAGTAGCAGCTAAGGATAATCAATACCTGTTTTTGTTGTTGCTACTACTACCTGTCTTTGT
TGTTGCTGCTAAGCCATTGAAACTCTTCATTGGTGCAGCCATTGGCAAAAGAGCTAGGAATAAGAGTGGTTCCAACTTTCAAGATTTTGAAGGATAACAAGGTTGTCAAGGAAGTGACCG
GTGCAAAATACGATGATCTGGTTGCAGCGATTGAAACAGCGAGGTCTGCTGCTTCCGGATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCTTTCTCTCCGTCTTTCTCCTTCGCCGACGGCTTTATCTCCGACTACCGGAGGATTTGGTCCATCGAGGAAACAGTGCCGGATTCCTTACTCCGGCGTCCCGACGACGAAGATT
GGTTTCTGTTCTTTGGATTCTAGGAAAAGAGGAGATTCCTCTGTTGTTAGGTGTAGCTTAGAAACCGTTAATGTCAGTGTTGGTCAGGTGACGGAGGTCGATAAGGACACGTTCTGGCCC
ATCGTTAAAGCCGCCGGTGAAAAGCTTGTCGTACTTGACATGTACACTCAATG
GTGTGGTCCATGTAAAGTGATTGCCCCTAAATACAAAGCTTTATCAGAGAAGTACGACGACGTTGTG
TTTCTAAAGCTTGACTGCAATCCAGATAACCGG
CCATTGGCAAAAGAGCTAGGAATAAGAGTGGTTCCAACTTTCAAGATTTTGAAGGATAACAAGGTTGTCAAGGAAGTGACCGGTGCA
AAATACGATGATCTGGTTGCAGCGATTGAAACAGCGAGGTCTGCTGCTTCCGGATGA

Retrieve as FASTA