Entry information : KflTrx02 (Kfl_008390050/WCGVC)
Entry ID 14224
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-04 (Christophe Dunand)
Peroxidase information: KflTrx02 (Kfl_008390050/WCGVC)
Name (synonym) KflTrx02 (Kfl_008390050/WCGVC)
Class Other Thioredoxin    [Orthogroup: Trx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflTrx02
start..stop
S start..stop
PpaTrx02 105 3e-30 31..133 32..136
ThasTrx05 102 2e-29 31..133 13..117
AtTrx05 101 9e-29 31..133 21..125
HaTrx05 98 2e-27 31..133 17..121
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19412..19570 159 N° 2 19101..19126 26 N° 3 18504..18768 265  
complement(join(18504..18768,19101..19126,19412..19570))


exon

Literature and cross-references KflTrx02 (Kfl_008390050/WCGVC)
Protein sequence: KflTrx02 (Kfl_008390050/WCGVC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   149
PWM (Da):   %s   16616.58  
PI (pH):   %s   7.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLAHKAGEVGTSGREEAYSPASHNHFLEAAGNLSVVKTDDDLKQLLKKSGNRPVVVNFGASWCEHCKLMVPELAKISKEFPKPLYVVADVDLLPETSKHVKYTPTFTVFHRSRKIDEFWGSNVQKLRDHIWLHEDLCDPPLPKAVPAKR

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGCCCATAAAGCTGGAGAGGTTGGCACGTCAGGCAGAGAAGAGGCTTACTCTCCAGCTTCGCATAACCACTTTCTAGAAGCAGCGGGGAACCTCTCCGTTGTGAAGACGGACGAT
GACCTGAAGCAGCTGTTGAAGAAGTCAGGCAACAGGCCG
GTAAGCCTTCTTTTGGCGGCCATGGATTCCCAAAACTTCAAGGTTTTCATGGTTTTCATAACTGTACAGCGTTTCTTGCGC
CATCAATCAGCTCAGATGTGACAGGTTTCAGTGGTCAACCAGCACGCCAAGGCAATGCTGAATGTTTCCTTTCTAGATCTTCAGCATCGGTGTTGTGAGAATGGCCGACTGTTCAGAAAC
GCTGTTGGAACGTCTCATTAAGTGACGGACTTCTATGATCTCCGGTTGTCATGTCTCAGCAGTTGTGCCATCAACTGATTGCAGGTGGTTGTGAATTTTGGAGCCTCTTGGTGAGCAGCG
CTCCACTGCTCCATTCGTCTGTTTGGTTGCTAAACAGCTGTGCCCTCTAAGTTTCTCACTACAAAAGGTAGCGGGTGCGAGATGCTGAATTGTAGTTGATTTTTCAGGAGCTTGATTGCT
GTCCATCTCTGAACATTTGCAACACTTTGCCAAACAAGCTGCAGACAGGAACGGCCGTTAGTTGCCATCTTTTGAGTTCCAAATGCATGAGTTTCAGGACGTTAAGTTTGAGTAGTTGGG
CGCCATTCTGGTTGACACCTCTCTTCCTGTCAAATCAAGCAACTGTATTGCCTCTAAGCGTCAGGTGTTTACCCCCGCTCAGGTGTGAACATTGTAAGCTCATGGTACCCGAGCTCGCCA
AGATTAGTAAAGAGTTCCCAAAGCCGCTCTACGTCGTCGCTGACGTGGACCTTCTGCCGGAGACGTCCAAGCACGTAAAGTACACACCCACGTTCACAGTGTTTCACCGGAGCCGAAAGA
TAGACGAGTTTTGGGGGTCGAACGTCCAAAAGCTGAGGGACCATATCTGGTTGCACGAAGATTTGTGTGATCCTCCCCTTCCGAAAGCAGTCCCCGCAAAGAGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGCCCATAAAGCTGGAGAGGTTGGCACGTCAGGCAGAGAAGAGGCTTACTCTCCAGCTTCGCATAACCACTTTCTAGAAGCAGCGGGGAACCTCTCCGTTGTGAAGACGGACGAT
GACCTGAAGCAGCTGTTGAAGAAGTCAGGCAACAGGCCG
GTGGTTGTGAATTTTGGAGCCTCTTGGTGTGAACATTGTAAGCTCATGGTACCCGAGCTCGCCAAGATTAGTAAAGAGTTC
CCAAAGCCGCTCTACGTCGTCGCTGACGTGGACCTTCTGCCGGAGACGTCCAAGCACGTAAAGTACACACCCACGTTCACAGTGTTTCACCGGAGCCGAAAGATAGACGAGTTTTGGGGG
TCGAACGTCCAAAAGCTGAGGGACCATATCTGGTTGCACGAAGATTTGTGTGATCCTCCCCTTCCGAAAGCAGTCCCCGCAAAGAGGTGA

Retrieve as FASTA