Entry information : AtTrx09(AT4G32580/Picot2)
Entry ID 14234
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2019-01-30 (Christophe Dunand)
Peroxidase information: AtTrx09(AT4G32580/Picot2)
Name AtTrx09(AT4G32580/Picot2)
Class Other Thioredoxin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtTrx09
start..stop
S start..stop
AtGrxS17 294 9e-100 1..155 1..161
ThasGrxS17-1 244 3e-80 1..154 1..164
ThasGrxS17-2 231 4e-75 1..155 1..161
HaGrxS01 204 5e-65 5..155 3..164
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15720365..15720535 171 N° 2 15720216..15720290 75 N° 3 15719878..15720114 237  
complement(join(15719878..15720114,15720216..15720290,15720365..15720535))


exon

Literature and cross-references AtTrx09(AT4G32580/Picot2)
Cluster/Prediction ref. Genebank:   829393
Omic ref. AtProteome:   At4g32580 ATTED-II:   At4g32580 e-FP Browser:   At4g32580 TAIR:   At4g32580
Protein sequence: AtTrx09(AT4G32580/Picot2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   160
PWM (Da):   %s   17252.82  
PI (pH):   %s   6.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSGTVKDIVSKEELDNLRHSGAPLVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAGSITPASLGLAAGPTILETVKKNAKASGQDRAQPVSTADALKNRLEKLTLLCYS*

Retrieve as FASTA  
Remarks Short homolog of PicotGRXS17 with only one TRX domain.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGGTACTGTGAAGGATATCGTTTCAAAGGAGGAGCTTGATAACTTGCGCCACAGCGGAGCACCACTCGTGCTTCACTTCTGGGCTTCTTGGTGTGACGCTTCGAAGCAGATGGAT
CAAGTTTTCTCTCATCTCGCTACTGATTTCCCTCGTGCTCACTTCTTTAGG
GTTCGTCGTCTCTGTTCGAATTTTATCTCTTTCAATTGGTTTTTGACTTTGATTGGTTTTATTTATCTT
CTTAGGTAGAAGCTGAGGAACATCCTGAGATATCTGAGGCTTATTCTGTTGCTCTTGTGCCGTATTTCGTCTTCTTCAAGGTAAACTTTAGGCATATTGATTCTTTGTTTGGTTGCAATT
TTTTGGCTTATTGACAAAGCTTGAATCTTTGTCACTGCACTGAATCCTTTTCTTATTGAAGGATGGCAAAACTGTGGATACACTTGAAGGGGCAGATCCATCAAGTTTAGCTAATAAAGT
TGGCAAAGTTGCTGGTTCTATTACTCCTGCAAGCTTAGGGTTGGCTGCAGGGCCAACGATTCTTGAAACTGTTAAGAAGAATGCGAAAGCTTCTGGACAAGACCGAGCTCAGCCTGTATC
TACCGCTGATGCTCTCAAGAATCGTTTGGAAAAACTCACCCTGTTATGTTATTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGGTACTGTGAAGGATATCGTTTCAAAGGAGGAGCTTGATAACTTGCGCCACAGCGGAGCACCACTCGTGCTTCACTTCTGGGCTTCTTGGTGTGACGCTTCGAAGCAGATGGAT
CAAGTTTTCTCTCATCTCGCTACTGATTTCCCTCGTGCTCACTTCTTTAGG
GTAGAAGCTGAGGAACATCCTGAGATATCTGAGGCTTATTCTGTTGCTCTTGTGCCGTATTTCGTCTTC
TTCAAG
GATGGCAAAACTGTGGATACACTTGAAGGGGCAGATCCATCAAGTTTAGCTAATAAAGTTGGCAAAGTTGCTGGTTCTATTACTCCTGCAAGCTTAGGGTTGGCTGCAGGGCCA
ACGATTCTTGAAACTGTTAAGAAGAATGCGAAAGCTTCTGGACAAGACCGAGCTCAGCCTGTATCTACCGCTGATGCTCTCAAGAATCGTTTGGAAAAACTCACCCTGTTATGTTATTCA
TGA

Retrieve as FASTA