Entry information : HaPNC08 (HanXRQChr11g0340371/HanXRQChr00c0095g0571661)
Entry ID 14239
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2017-11-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC08 (HanXRQChr11g0340371/HanXRQChr00c0095g0571661)
Name (synonym) HaPNC08 (HanXRQChr11g0340371/HanXRQChr00c0095g0571661)
Class Plantacyanin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC08
start..stop
S start..stop
HaPNC21 187 2e-63 1..125 1..126
HaPNC19 187 2e-63 1..125 1..126
HaPNC13 187 2e-63 1..125 1..126
HaPNC10 187 2e-63 1..125 1..126
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22164..22341 178 N° 2 21797..21996 200  
complement(join(21797..21996,22164..22341))


exon

Literature and cross-references HaPNC08 (HanXRQChr11g0340371/HanXRQChr00c0095g0571661)
DNA ref. HanXRQ genome:   HanXRQChr00c0095 (22341..21797)
Protein sequence: HaPNC08 (HanXRQChr11g0340371/HanXRQChr00c0095g0571661)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   125
PWM (Da):   %s   13028.3  
PI (pH):   %s   4.48
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVGRGSARVAMAALCLLLVVLQCEVTQAATYVVGDDNGWSSNIGGWEEGKTFKADDILVFNYQQGAHNVVVVSEEGYDGCSATPSDKVYTSGNDQITLVKGLNNFICGFPGHCAAGMKLQISAS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTGGGAAGAGGCAGTGCAAGGGTAGCAATGGCGGCGCTCTGTCTCCTACTGGTGGTGCTTCAATGCGAGGTAACTCAGGCTGCTACTTATGTTGTTGGCGATGACAATGGTTGG
TCGTCTAACATCGGAGGTTGGGAGGAAGGCAAGACGTTCAAGGCCGACGACATCCTTG
GTATCCTCTCTAAATACTATCATCACTTTACATGCCTACATTAGCTACAAAATTATATAGTC
TCAACCAATTACTTAACTTAATATATGTTGAATTAATAAAAGAACAGTTTAACAACAAATAAATGCTTATTTAATTGTATTATTTTTTTTTTATGATCGTAACAGTGTTTAACTATCAAC
AAGGAGCACATAATGTTGTGGTAGTGAGCGAGGAAGGATATGATGGGTGCAGCGCCACCCCAAGCGACAAGGTGTACACAAGTGGAAATGACCAAATTACCCTTGTGAAGGGTCTTAACA
ACTTCATTTGTGGTTTCCCTGGTCATTGTGCTGCTGGCATGAAGCTTCAAATCTCTGCATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTGGGAAGAGGCAGTGCAAGGGTAGCAATGGCGGCGCTCTGTCTCCTACTGGTGGTGCTTCAATGCGAGGTAACTCAGGCTGCTACTTATGTTGTTGGCGATGACAATGGTTGG
TCGTCTAACATCGGAGGTTGGGAGGAAGGCAAGACGTTCAAGGCCGACGACATCCTTG
TGTTTAACTATCAACAAGGAGCACATAATGTTGTGGTAGTGAGCGAGGAAGGATATGATGGG
TGCAGCGCCACCCCAAGCGACAAGGTGTACACAAGTGGAAATGACCAAATTACCCTTGTGAAGGGTCTTAACAACTTCATTTGTGGTTTCCCTGGTCATTGTGCTGCTGGCATGAAGCTT
CAAATCTCTGCATCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTGG GAAGAGGCAG TGCAAGGGTA GCAATGGCGG CGCTCTGTCT CCTACTGGTG GTGCTTCAAT GCGAGGTAAC TCAGGCTGCT ACTTATGTTG TTGGCGATGA CAATGGTTGG  TCGTCTAACA TCGGAGGTTG GGAGGAAGGC AAGACGTTCA AGGCCGACGA CATCCTTGTG TTTAACTATC AACAAGGAGC ACATAATGTT GTGGTAGTGA GCGAGGAAGG ATATGATGGG  TGCAGCGCCA CCCCAAGCGA CAAGGTGTAC ACAAGTGGAA ATGACCAAAT TACCCTTGTG AAGGGTCTTA ACAACTTCAT TTGTGGTTTC CCTGGTCATT GTGCTGCTGG CATGAAGCTT 
CAAATCTCTG CATCTTAA 

Retrieve as FASTA