Entry information : HaUCC01 (HanXRQChr04g0106051)
Entry ID 14240
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2017-11-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaUCC01 (HanXRQChr04g0106051)
Name (synonym) HaUCC01 (HanXRQChr04g0106051)
Class Uclacyanin    [Orthogroup: UCC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaUCC01
start..stop
S start..stop
HaUCC04 129 2e-38 7..183 8..180
ThasUCC02-2 125 5e-37 1..126 9..132
ThasUCC02 112 3e-32 1..128 9..132
AtUCC04 112 8e-32 18..123 20..125
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 62138798..62138957 160 N° 2 62139099..62139493 395  
join(62138798..62138957,62139099..62139493)


exon

Literature and cross-references HaUCC01 (HanXRQChr04g0106051)
DNA ref. HanXRQ genome:   HanXRQChr04 (62138798..62139493)
Protein sequence: HaUCC01 (HanXRQChr04g0106051)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   184 (163)
PWM (Da):   %s   18994.04 (16840.9)  
PI (pH):   %s   5.48 (4.85) Peptide Signal:   %s   cut: 22 range:22-184
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIAAYFLISILGVAARSAYAVQHIVGDSNGWTNFGDYTTWAASKTFNVGDTLLFNYGSSHGVDVVSKSDYDNCATGNAIDSYTSGPTTVKLTQPGPMYFACPSFGHCSTGMKLAINVVSQSSNTPTTTTPSDGSNSSPPSTTNPSTPSTSNPTKDVGSSSADRANMMVVGFSMILAPLVVFIC

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATTGCTGCATATTTTCTTATTTCGATATTAGGCGTCGCAGCACGATCAGCGTATGCAGTGCAACATATCGTCGGTGATAGCAACGGCTGGACCAATTTCGGAGATTATACTACG
TGGGCTGCTAGTAAAACGTTCAACGTTGGGGACACGCTTT
GTGAGTATTCATCATCCACATTTAAAAAAAACTATATGAAAAACATTAATTCGTCTATATGTGACATGTTTTTTTTAATA
CCAAAAACATAATAAATTTTGGCAGTATAATTATAACTTTGTGATGATTTTTGTTGGGCAGTGTTCAACTACGGTAGTAGCCATGGTGTGGATGTTGTATCTAAATCCGATTATGACAAC
TGCGCTACGGGTAATGCCATCGACTCCTACACTAGCGGACCAACCACCGTTAAACTAACACAACCAGGGCCAATGTATTTTGCTTGCCCATCATTTGGTCACTGTAGTACGGGGATGAAA
CTCGCGATCAACGTGGTATCTCAAAGTTCCAACACGCCGACCACCACAACCCCTAGCGACGGTAGCAATTCATCGCCACCATCTACCACCAACCCATCTACACCATCAACTTCAAACCCC
ACCAAGGATGTTGGTTCAAGTTCAGCCGATCGTGCAAACATGATGGTGGTCGGCTTTTCTATGATTTTGGCACCATTGGTTGTGTTCATATGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATTGCTGCATATTTTCTTATTTCGATATTAGGCGTCGCAGCACGATCAGCGTATGCAGTGCAACATATCGTCGGTGATAGCAACGGCTGGACCAATTTCGGAGATTATACTACG
TGGGCTGCTAGTAAAACGTTCAACGTTGGGGACACGCTTT
TGTTCAACTACGGTAGTAGCCATGGTGTGGATGTTGTATCTAAATCCGATTATGACAACTGCGCTACGGGTAATGCCATC
GACTCCTACACTAGCGGACCAACCACCGTTAAACTAACACAACCAGGGCCAATGTATTTTGCTTGCCCATCATTTGGTCACTGTAGTACGGGGATGAAACTCGCGATCAACGTGGTATCT
CAAAGTTCCAACACGCCGACCACCACAACCCCTAGCGACGGTAGCAATTCATCGCCACCATCTACCACCAACCCATCTACACCATCAACTTCAAACCCCACCAAGGATGTTGGTTCAAGT
TCAGCCGATCGTGCAAACATGATGGTGGTCGGCTTTTCTATGATTTTGGCACCATTGGTTGTGTTCATATGCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TATAATCACA TGTTCTTCAC CACTTTGTCA CAAGAACAAT ACTTTCACTA CATAATTGAC ATTCAAAAAC CAAACTATGG CAATTGCTGC ATATTTTCTT ATTTCGATAT TAGGCGTCGC  AGCACGATCA GCGTATGCAG TGCAACATAT CGTCGGTGAT AGCAACGGCT GGACCAATTT CGGAGATTAT ACTACGTGGG CTGCTAGTAA AACGTTCAAC GTTGGGGACA CGCTTTTGTT  CAACTACGGT AGTAGCCATG GTGTGGATGT TGTATCTAAA TCCGATTATG ACAACTGCGC TACGGGTAAT GCCATCGACT CCTACACTAG CGGACCAACC ACCGTTAAAC TAACACAACC  AGGGCCAATG TATTTTGCTT GCCCATCATT TGGTCACTGT AGTACGGGGA TGAAACTCGC GATCAACGTG GTATCTCAAA GTTCCAACAC GCCGACCACC ACAACCCCTA GCGACGGTAG  CAATTCATCG CCACCATCTA CCACCAACCC ATCTACACCA TCAACTTCAA ACCCCACCAA GGATGTTGGT TCAAGTTCAG CCGATCGTGC AAACATGATG GTGGTCGGCT TTTCTATGAT  TTTGGCACCA TTGGTTGTGT TCATATGCTA GGAAAGAGGC AGTGCTTATT GCTATTGTTA TGTGTTTATT GTTTAAATTT ATGTGCCTTT TAAATATCTG TTTTCCGCTT CAATGAAAAA  TAACTGAAAA GTAAAATATT TAATATGTTT ATACAAGTAA CTAGAGGTGT AAAAAAACCA ATTGGTGTTG GGCAAACCGG AAACCAACCC GGTAAAAAAA ACGGTTTGAC CCAAACTGGA 
TTGGGTCCAA CAGACCCGGC GGTTTGGTAT AGGTTTGTAA TTTT 

Retrieve as FASTA