Entry information : HaMDAR04 (HanXRQChr14g0450411)
Entry ID 14252
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2017-11-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaMDAR04 (HanXRQChr14g0450411)
Name (synonym) HaMDAR04 (HanXRQChr14g0450411)
Class Monodhydroascorbate Reductase    [Orthogroup: MDAR002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaMDAR04
start..stop
S start..stop
HaMDAR02 831 0 1..480 1..480
ThasMDAR03 695 0 1..480 1..490
AtMDAR03 690 0 1..480 1..488
PpaMDAR04 578 0 1..479 1..484
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 141378756..141378875 120 N° 2 141377646..141377697 52 N° 3 141377425..141377505 81 N° 4 141377169..141377287 119
N° 5 141376840..141377059 220 N° 6 141376636..141376754 119 N° 7 141375821..141376552 732  
complement(join(141375821..141376552,141376636..141376754,141376840..141377059,1 41377169..141377287,141377425..141377505,141377646..141377697,141378756..1413788 75))


exon

Literature and cross-references HaMDAR04 (HanXRQChr14g0450411)
DNA ref. HanXRQ genome:   HanXRQChr14 (141378875..141375821)
Protein sequence: HaMDAR04 (HanXRQChr14g0450411)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   480
PWM (Da):   %s   52160.96 Transmb domain:   %s   o452-474i
PI (pH):   %s   6.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRSFVYVILGGGVAAGYAALEFANKGVAHGELCIISDEPVAPYERPALSKGFLLPEAPARLPAFHTCVGVNEERLTPKWYKEHGIELILDTRVTSADVRRKTLVTAAGETISYKFLIIATGAAFKLEEFGVSGSDAENVCHLRDLADATRLVDLMQASTGGNAVVIGGGYIGMEVAASLVINKINVTMVFPEPHCIPRLFTPKIASFYEEFYKSKGVNFVKGTVLSSFVINPEGKVIGVNLKDGSYLPADLVVVGIGIRRNTSLFEGQLTLEKGGIKVNSMLQTSNSSVYAVGDVASFPVKAFGEIRRLEHVDAARKSARHAVSAIMEPDTTPEFDYLPFFYSRAFLFSWQFYGENLGEAVYFGDFSGTSFGAYWVHNGHLVGSFLEGGSKEEYEALAKATRLRPAIDDMSDLERQGLRFVVTLSQKQPVLPIVDVGSSTSLVVLEKPEYPWHAAAGVVAAASIAAFAYWYGRRRRRW

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGATCGTTTGTGTACGTGATACTTGGTGGAGGAGTGGCTGCCGGTTATGCAGCTCTTGAGTTCGCCAACAAAGGTGTCGCTCATGGTGAACTCTGCATCATCTCCGATGAACCT
GTAATCTTCCGTCCTCATTCACATCAAATATCCTAGTTAACAACCCTTAATCTGTTTCAGACGTGAATTCGTTGATTTTCATTGATCATCTTGTTTGTTGAATCTGATCATTGAGTTTCG
GTTTTATCTCTTGCACGCCAAGTGTTTGTTGTTTTACCCTGGTCTGGTGTGTGTTTTAAAAACTATGATTGATTGGGGAACTTAAAGGTTTGCAATATACTTTGATTTTCCAGTTATATA
TATATATATATATATATATATATATATATATATATTGGAGTGAATCTAATTAAGGAAAAGGAAAATTTTATTGAATGCTTAGAAACTGAGATGAGAACAGAGAATTCAGAGGAGATGACG
AGAAAAGAAAATACAAAAGTCAATTTGCGTGTCCATGGTGCTGCTGCTGATGTGGCATTCATGACATAACCATTCCATTTGCTAGGATCCTTTCTGACCCAGTTCCTTGCTAGGTTGAAT
TTGATCACTGTTGTACTTGACCCGTATCGGCTTGGTTCGGGACCTGTATTGCCATTGGTGTTCATAACATAAATTGAATTAGTTCTGTAGTTTGATTGGGAGTTTAAAGGCAGTGGATTT
CATGAATCTTGATTGCTTCTGCACATATGTTTGACTTTCCTAGCCTATGTAGTCATGTAAATCCATTTTTTTTAGTTTCGATGATCAATTTGAGTTAGCTCCAAAGGCTCCAAAATATCT
TATCAAATTGGAATTTAGATGTGAAGGGTAGTTTAGCTAGAGTTGTAGATCATCACGATCAGGTTCGGTAACCTGTGCATTTTGGAAAGTGTTATAAAACGGTGAAATTGGCTTAACCCA
TGTTTGAAATATCATGCTAGTTTGTCTTTCACAATCACATTGAACATGAGGTGGTTATTCTATTAATTTAAATCCAAACCAATTTCTTGATCATGTAAAATTCATTTGTAGCGTATATAT
TTGCGTTAGAACATAGAACAAGAATGCATGATAATAAAAGCACATGTAGTTCATATTTTGGCTTTCTTAGATACACATCTCATCTTGATAATGTGCAGGTGGCTCCTTATGAAAGACCTG
CACTCAGCAAAGGCTTTCTACTCCCAGAAG
GTACCTATTGTATATCAAAAATTAAATAGTGTCAAAGTGGTCTTGATTCCTTATAAAGTTTAATATCCAATCACAAGTTGCCTTATTAGC
GTCATCAATGTCTTCTTTTTGACTCTGTATTTTGTAATTGTTCCACACAGCTCCTGCACGTCTACCTGCATTTCACACGTGTGTAGGCGTCAATGAAGAGAGGTTAACACCTAAGTGGTA
CAAGGAACATG
GTAAATGTTGTTCATAAACCGATGATGATAAGTGTTCTTATAGTATGTAATGAACATATACTGTTATAAGTATCATAATGCGTTATAAATAGACCTGATAATGAAAACA
TAAAAACTTAATGCAAAAATTATTTCAGGAATTGAACTGATTCTTGATACTCGGGTAACGTCTGCTGATGTAAGACGTAAGACACTTGTAACTGCAGCAGGAGAAACAATCAGCTATAAA
TTTCTTATCATTGCAACAGGTGCTCGG
GTACTGAAGCTTGTTCTCAAACAATATTATGTATATATTATATTTCTTGAACTAAAAAAAAAAATAGGAGTATTTTATTTCTTGAATTATTCG
TATGGCCTGGTTACAGGCTTTTAAGCTTGAAGAGTTTGGTGTAAGCGGATCAGACGCTGAAAATGTATGTCATCTGCGTGATTTGGCCGATGCAACCAGGCTTGTGGACCTGATGCAAGC
CTCTACTGGCGGTAATGCGGTGGTTATTGGTGGTGGCTACATTGGAATGGAGGTTGCTGCATCCTTGGTCATAAATAAGATTAATGTTACCATGGTGTTTCCTGAGCCACACTGCA
GTAA
GCACTTTCATTTTTCAAACTTATCTGTTTTCTTTGTATAAGTTCTAGTCAAATTAAAGCACCGTTTTCATCTTTTTTGTAGTACCCCGTTTATTCACCCCAAAGATTGCAAGTTTTTATG
AAGAGTTTTATAAATCAAAGGGTGTAAATTTTGTCAAAGGCACAGTTTTGTCATCGTTTGTTATCAATCCTGAGGGGAAG
GTAAACACAAGTCAAATTAGCGTCATTAACGGAGAATGAG
TCAATGTTAAATTAGCGTCATTAACCGAACTGATTGTATACAGGTTATTGGAGTTAATCTGAAGGATGGAAGCTATCTTCCTGCTGACTTGGTGGTCGTAGGAATTGGAATCCGTCGAAA
CACAAGTCTATTCGAAGGCCAACTCACTCTAGAGAAAGGAGGAATCAAAGTAAACAGCATGTTGCAAACGAGCAACAGCTCGGTGTATGCAGTTGGTGACGTGGCATCATTTCCGGTAAA
GGCTTTTGGTGAAATCCGACGGCTTGAACACGTTGATGCTGCTAGAAAATCAGCTCGCCATGCTGTCTCTGCGATAATGGAACCAGATACTACACCAGAATTCGATTACCTGCCATTCTT
CTATTCCAGGGCATTCTTGTTTTCGTGGCAGTTTTATGGAGAAAATTTGGGAGAAGCCGTTTATTTCGGAGATTTTTCAGGAACTAGTTTTGGTGCATACTGGGTCCACAATGGTCATCT
AGTAGGATCTTTTCTCGAAGGTGGAAGTAAAGAAGAGTATGAGGCGCTAGCCAAAGCGACGAGGCTTAGACCGGCGATTGATGATATGAGTGACCTCGAGCGGCAGGGTCTAAGGTTTGT
GGTGACACTGAGCCAGAAACAACCGGTGCTGCCTATAGTGGATGTGGGGAGTTCGACATCACTTGTTGTTTTAGAAAAACCGGAGTACCCTTGGCATGCAGCTGCAGGGGTGGTGGCAGC
GGCTTCGATAGCTGCATTTGCTTATTGGTATGGAAGAAGACGCCGGCGATGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGATCGTTTGTGTACGTGATACTTGGTGGAGGAGTGGCTGCCGGTTATGCAGCTCTTGAGTTCGCCAACAAAGGTGTCGCTCATGGTGAACTCTGCATCATCTCCGATGAACCT
GTGGCTCCTTATGAAAGACCTGCACTCAGCAAAGGCTTTCTACTCCCAGAAGCTCCTGCACGTCTACCTGCATTTCACACGTGTGTAGGCGTCAATGAAGAGAGGTTAACACCTAAGTGG
TACAAGGAACATG
GAATTGAACTGATTCTTGATACTCGGGTAACGTCTGCTGATGTAAGACGTAAGACACTTGTAACTGCAGCAGGAGAAACAATCAGCTATAAATTTCTTATCATTGCA
ACAGGTGCTCGG
GCTTTTAAGCTTGAAGAGTTTGGTGTAAGCGGATCAGACGCTGAAAATGTATGTCATCTGCGTGATTTGGCCGATGCAACCAGGCTTGTGGACCTGATGCAAGCCTCT
ACTGGCGGTAATGCGGTGGTTATTGGTGGTGGCTACATTGGAATGGAGGTTGCTGCATCCTTGGTCATAAATAAGATTAATGTTACCATGGTGTTTCCTGAGCCACACTGCA
TACCCCGT
TTATTCACCCCAAAGATTGCAAGTTTTTATGAAGAGTTTTATAAATCAAAGGGTGTAAATTTTGTCAAAGGCACAGTTTTGTCATCGTTTGTTATCAATCCTGAGGGGAAG
GTTATTGGA
GTTAATCTGAAGGATGGAAGCTATCTTCCTGCTGACTTGGTGGTCGTAGGAATTGGAATCCGTCGAAACACAAGTCTATTCGAAGGCCAACTCACTCTAGAGAAAGGAGGAATCAAAGTA
AACAGCATGTTGCAAACGAGCAACAGCTCGGTGTATGCAGTTGGTGACGTGGCATCATTTCCGGTAAAGGCTTTTGGTGAAATCCGACGGCTTGAACACGTTGATGCTGCTAGAAAATCA
GCTCGCCATGCTGTCTCTGCGATAATGGAACCAGATACTACACCAGAATTCGATTACCTGCCATTCTTCTATTCCAGGGCATTCTTGTTTTCGTGGCAGTTTTATGGAGAAAATTTGGGA
GAAGCCGTTTATTTCGGAGATTTTTCAGGAACTAGTTTTGGTGCATACTGGGTCCACAATGGTCATCTAGTAGGATCTTTTCTCGAAGGTGGAAGTAAAGAAGAGTATGAGGCGCTAGCC
AAAGCGACGAGGCTTAGACCGGCGATTGATGATATGAGTGACCTCGAGCGGCAGGGTCTAAGGTTTGTGGTGACACTGAGCCAGAAACAACCGGTGCTGCCTATAGTGGATGTGGGGAGT
TCGACATCACTTGTTGTTTTAGAAAAACCGGAGTACCCTTGGCATGCAGCTGCAGGGGTGGTGGCAGCGGCTTCGATAGCTGCATTTGCTTATTGGTATGGAAGAAGACGCCGGCGATGG
TGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGCCATAGA GGTCTATTTT TATCCAACAT CTTTCTTGTG TGTGTGTGTG TATATATAGA GAGAGAGAGT GAGTGTGTGT GAGAGAGAAA GAGCGGGTAA ATGGGAAGAT CGTTTGTGTA  CGTGATACTT GGTGGAGGAG TGGCTGCCGG TTATGCAGCT CTTGAGTTCG CCAACAAAGG TGTCGCTCAT GGTGAACTCT GCATCATCTC CGATGAACCT GTGGCTCCTT ATGAAAGACC  TGCACTCAGC AAAGGCTTTC TACTCCCAGA AGCTCCTGCA CGTCTACCTG CATTTCACAC GTGTGTAGGC GTCAATGAAG AGAGGTTAAC ACCTAAGTGG TACAAGGAAC ATGGAATTGA  ACTGATTCTT GATACTCGGG TAACGTCTGC TGATGTAAGA CGTAAGACAC TTGTAACTGC AGCAGGAGAA ACAATCAGCT ATAAATTTCT TATCATTGCA ACAGGTGCTC GGGCTTTTAA  GCTTGAAGAG TTTGGTGTAA GCGGATCAGA CGCTGAAAAT GTATGTCATC TGCGTGATTT GGCCGATGCA ACCAGGCTTG TGGACCTGAT GCAAGCCTCT ACTGGCGGTA ATGCGGTGGT  TATTGGTGGT GGCTACATTG GAATGGAGGT TGCTGCATCC TTGGTCATAA ATAAGATTAA TGTTACCATG GTGTTTCCTG AGCCACACTG CATACCCCGT TTATTCACCC CAAAGATTGC  AAGTTTTTAT GAAGAGTTTT ATAAATCAAA GGGTGTAAAT TTTGTCAAAG GCACAGTTTT GTCATCGTTT GTTATCAATC CTGAGGGGAA GGTTATTGGA GTTAATCTGA AGGATGGAAG  CTATCTTCCT GCTGACTTGG TGGTCGTAGG AATTGGAATC CGTCGAAACA CAAGTCTATT CGAAGGCCAA CTCACTCTAG AGAAAGGAGG AATCAAAGTA AACAGCATGT TGCAAACGAG  CAACAGCTCG GTGTATGCAG TTGGTGACGT GGCATCATTT CCGGTAAAGG CTTTTGGTGA AATCCGACGG CTTGAACACG TTGATGCTGC TAGAAAATCA GCTCGCCATG CTGTCTCTGC  GATAATGGAA CCAGATACTA CACCAGAATT CGATTACCTG CCATTCTTCT ATTCCAGGGC ATTCTTGTTT TCGTGGCAGT TTTATGGAGA AAATTTGGGA GAAGCCGTTT ATTTCGGAGA  TTTTTCAGGA ACTAGTTTTG GTGCATACTG GGTCCACAAT GGTCATCTAG TAGGATCTTT TCTCGAAGGT GGAAGTAAAG AAGAGTATGA GGCGCTAGCC AAAGCGACGA GGCTTAGACC  GGCGATTGAT GATATGAGTG ACCTCGAGCG GCAGGGTCTA AGGTTTGTGG TGACACTGAG CCAGAAACAA CCGGTGCTGC CTATAGTGGA TGTGGGGAGT TCGACATCAC TTGTTGTTTT  AGAAAAACCG GAGTACCCTT GGCATGCAGC TGCAGGGGTG GTGGCAGCGG CTTCGATAGC TGCATTTGCT TATTGGTATG GAAGAAGACG CCGGCGATGG TGAGAGTTGC GGGTTGATTA  TTTTCACGAT GAATACACAC CCCCTAAAAT TTGTTATTAA AATCAACTTA TTGAGTCCAA GTTTAGTGCC TATACCCTTG TTGTGCAATT TCAGTAGGAG GTTTGGACAA CACGAATACT  CATGTGCTAT GACAGTAAGA CTTGTATACA TAACATAATC AAAATATTCT ATCATGTATA GCATATGTGT TCATGTAAAA GGATATTTAA TTTCTGTAAA TTAGTATCTT TGTTATGGTT 
TCATATAAAA AGTTCTTTTT CTTGTA 

Retrieve as FASTA