Entry information : HaMDAR02 (HanXRQChr07g0198871)
Entry ID 14256
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2017-11-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaMDAR02 (HanXRQChr07g0198871)
Name (synonym) HaMDAR02 (HanXRQChr07g0198871)
Class Monodhydroascorbate Reductase    [Orthogroup: MDAR002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaMDAR02
start..stop
S start..stop
HaMDAR04 804 0 1..480 1..480
ThasMDAR03 732 0 1..480 1..490
AtMDAR03 731 0 1..480 1..488
MpMDAR02 585 0 1..479 1..483
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 77322448..77322567 120 N° 2 77321895..77321946 52 N° 3 77321679..77321759 81 N° 4 77320307..77320425 119
N° 5 77319984..77320203 220 N° 6 77319344..77319462 119 N° 7 77318048..77318779 732  
complement(join(77318048..77318779,77319344..77319462,77319984..77320203,7732030 7..77320425,77321679..77321759,77321895..77321946,77322448..77322567))


exon

Literature and cross-references HaMDAR02 (HanXRQChr07g0198871)
DNA ref. HanXRQ genome:   HanXRQChr07 (77322567..77318048)
Protein sequence: HaMDAR02 (HanXRQChr07g0198871)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   480
PWM (Da):   %s   51974.9 Transmb domain:   %s   o451-473i
PI (pH):   %s   7.01
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRAFVYVILGGGVAAGYAALEFTKKGVSHGELCIISEEPVAPYERPALSKGFLLPEAPARLPAFHTCVGANEERLTPKWYKEHGIELILGTRVKSADVRRKTLLTAAGETISYKYLIIATGAALRLEEFGVSGSDAENVCYLRDLADATRLADVMQTSTGGNAVVIGGGYIGMEVAASLVINKINVSMVFPEPHCMGRLFTPKIASYYEEFYKAKGVNFVKGTVLSSFVFDEDGKVTGVNLKDGTDLPADLVVVGIGIRPNTSLFEGQLTLEKGGIKVNSRLQTSNSSVYAVGDVASFPVKIFGESRRLEHVDAARKSARHAVAAIMEPDTTPEFDYLPFFYSRVFSFSWQFYGDNLGEVIYFGDFSGPSFGAYWVHKGHLVGSFLEGGSKEEYEAIAKVTRLKPAVDDLSELERQGLGFVVALSEKLPVAPVINVGGSMSTVVLEKPLYAWHATAGVVVAASIAAFAYWYGRRRRRW

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGAGCGTTTGTGTATGTGATACTTGGTGGGGGAGTTGCTGCCGGTTATGCAGCTCTTGAATTCACCAAAAAAGGTGTTTCTCACGGTGAACTCTGCATCATCTCCGAAGAACCT
GTAATAATTCATCCTCGATTTCATCAACTTCAATCGATTTTTGTACTTGACAACTGTGGGAACTTAATCTGTTATGTTTTTAGTTTTGATTGATGATCTTGTATGTTGAAATTGGGTGTT
GATGTTTGGTTTAGTTTCTTGCACGCAAGGTGTTTGATGAATTGCCTCACTTGTTTTTCACATTAATTGTGACCCAAGAAAAAAGTATTGGTAATTTGGTTGTGGGTTTTAATGATTATC
AAACAGTTTTGCTATATTAAATGATGGATGGAGCAAAATTCAACTTGATTTTAGGCAGGCTTAAGTTGAATAATAGCAGGTCTACTTGTGCATATAAAAAGTCTGAATTTTGATGAAACT
TATGCATAGCGTGCAATATGTTTCATCGATTTTAATCGGGTTTTGTTCATATTCGTGTTGGTGATTCGTTGATTTTAATCGATCATCGTGTTTGTTGAAATTGATTGCTAATGTTTGATA
TATATTTGTTGTAATCTGCAGGTGGCTCCTTACGAGAGACCCGCACTCAGCAAAGGCTTTCTACTTCCAGAAGGTGACTCACGTTATATTTTCGTCTTTTATTACAGATCGATACACATC
TCAAGAAAGTCAAAATGATCACAAGTTATGTTACAGTCTCATCAATCTCACCTTTTTAAACTTTGTGTTCTGTAATTGTTCAACGCAGCTCCGGCACGTCTTCCCGCATTTCACACTTGT
GTCGGTGCCAATGAAGAAAGATTAACGCCGAAGTGGTACAAGGAACATG
GTAAATATATCTTTCTTGAATTGATAATACTTGTTTTTATAATATGTTTGATGAACAAGTACTGTTAGGCC
TCTAAGTGAACCGCGTGAACAGAAGCATGTTTGTGTTCGTTCATTTAACTTTAACCCTTGGTTTAAAAAAGCGCGCTTTAAGCGAGCTTAAAGCGTGAGGCGCTGAAGCGCTGGGAATGT
CGCTTTTTTTGCTCTGAGGCGTCACAACACGTGAAGCGTTTTGAGGCGAGCTTTAAGCGCGAAGCAACCTTGGTTTGAGGCGACGCTTCAGCCCAATCAGGTCACATTTGGGTCATTTAT
TTAGGCCCAATAGTCTTTAAATAGGGTTTAAATGAAGCCACTACTTCTTTACCCTAAAAAAAGAACGTTAGCTATCTTTTAACATATTCAGCCGCTCCCTTCCGCTTCTCCTGTGATTCT
TCATACTTTCTCCAATAATCAGCATTAAAGACTATTTTTATGTTTATGTTTATGTTTTAAGTGTGCTTCGACTTTAATTTATGTTTTAACTATGTTTTTTATGTGTTAAGTGTGTTTTTA
AATCATGTTTTATTGTTTATTATTGATTAACAAGTAGAATAGGTCATATTGATGTGTACAATATTTTTTTTATTTTTTTTTATTTTGAGCGCTTCGTATACGTGAAGCTCTCGCTTCGCG
CTTGAAGCTTCGCTTAAAGCTTTTGCAACCAAAACGCTTCGGAGCGCTTCGCGCTTTTTTAAACCAAGCTTTAACCGAACAAAATTTTTTGTTCGTGTTTGTTTATTAAAAATGGGCATG
TTCGTGTTCCTTTATGTTCGTTCGTTTAAACAAACCTAATAATTTAACAAACATAAAACAACACAAATGAACATAAATGATCAAACACAAACGGACGTAAAGTAGCTTTTTTATATAAAT
GGTTAAATAATTATGATAGGTTCCATTGGAAAGTCCAACTATCAGTTAGTTATATTTTTATAAATAGTTAGAAAGCGCGTTTTATGTTTATATTTATATAAATATAACTACTTATGTATT
TATTATAATGTAAGCGAACATAACGGACGTTCACGAACATAAATGAACGAACGACATGTGTGTTCATGTTCGTTCGTTTATTAAATAAACAAATATAAACGAACTTCCCGCCGAACAAGT
TCATGAACGTTCGGTTCGTTTACAGGCCTAAGTACTGCTACAAATATTATCATATTTATAGATTCACTTGATAACAAAAACATAATACATAAATTATTTCAGGAATCGAACTGATTCTGG
GTACGCGCGTAAAGTCTGCTGACGTGAGGCGTAAAACATTACTCACTGCAGCAGGAGAAACCATTAGCTATAAGTATCTTATCATTGCAACAGGTGCTCGG
GTACTGAAACCGGTTCTCA
AAGGATATCATACATTCATACTTCGTTTCTTTACAATTTTTTTAACAAGACTATATTTCCTAATTGATTTGTTGGATTAAATAGGCTTTGAGACTTGAAGAGTTCGGTGTAAGTGGATCA
GATGCTGAAAATGTATGTTATCTACGTGATTTGGCTGACGCAACCAGGCTTGCGGACGTGATGCAAACCTCTACTGGCGGCAATGCGGTGGTCATTGGCGGTGGCTACATTGGAATGGAG
GTTGCGGCGTCGTTGGTCATTAATAAGATTAATGTTTCAATGGTGTTCCCTGAGCCACATTGCA
GTAAGCGCTTAGCTATTTTCTTCTTTCTTTTATATATGAGTAAAATGCCATTTTCA
TCCTTGAGGTTTTGCCATTTTGCGGCTTTTATCCAAAGGTTTGTTTTTTCGCTGTTGGATCCAAAAGGTTTGAAAGCTTGCTATTTTCATCTGGCCCGTTAACTCCATCCATTTTTCTCC
GTCAAGTCAGCGGTATATCAGTCTTTTTTGCTAACGTAAACGGCAATTCGGTCTTTTTCACTTTATGTAAAACACACTGAATACCCCTGAAAAAGACCGAATTGCCCTTCAAGCTAACAA
AAAAGACGGAAGTACCCCTGACTTAACGGAGAAAATTGGATGGAGTTAACGAGCCGGATGAAAACAACAAGATTTCAAACCTTTTGGATCCAGATGCGGAAAAACAAACCTTTGGCACGA
AAGTCTCAAAACTGGCCAAACCTCGGGACGAAAATGGCATTTTACTCTTTATATCATTTATTAAGTTCTAGTCGAGCTGAAGAATATTGATATATATTTTTTCAGTGGGCCGTTTATTCA
CCCCCAAGATTGCAAGTTATTATGAAGAGTTTTATAAAGCTAAGGGTGTAAACTTTGTCAAAGGCACAGTTCTGTCATCATTTGTTTTCGATGAAGATGGGAAG
GTAAATTTTAAGCTCT
TTTTTGCTCGGTTAGGGTGTTAAACGGGTGGTGTTTGCGGGCTGGCGGGTACAACGCGATATGAACCTGGAAATTTGACATGAACCCGAACACGACACGAATCCAATAATAGTGTCTGAT
ATATGAACCCAGAAACGACCTGAATATTCGCGGGTCGACACAAACCGTTGAACTCGATTTTTATTATTATTATTGAAAATCATTTCTGCATTTTTGTACTTGAAATTTATAAATTTCTAA
CTAAATATACAAAAACGTATAAAACAATTATGTTTAAATTATAAAACTTGATGTGAATTTGTCTTTTTAACTTTTAAATTTTCACAAAAGAATGCCAAATCATGACATAAAACAATTAAT
TATTATTATTATTTTATTTTTATTTATTTATTTATAAAAAAAGCTGATCTAAACATGACCTGTTTAGATAAACGTGACTGCGGGCTCGACCCAAAATTGACCCCAATCCATTTGCGTGTG
TCGGTTATGACCCATTTGAGTCCAATCCGAGTCAAAAATGGTTCACTAACCGAATCGGTTCTATGTAGGTCACCGGAGTTAACCTCAAGGATGGAACCGATCTTCCTGCTGACTTGGTAG
TCGTCGGAATCGGAATCCGACCAAACACAAGTCTATTTGAAGGGCAACTCACTTTAGAAAAAGGCGGGATCAAAGTTAACAGCAGGTTGCAAACGAGCAACAGCTCTGTGTACGCAGTAG
GTGACGTGGCATCGTTTCCAGTCAAGATCTTTGGCGAAAGCCGACGACTCGAACACGTCGATGCCGCCAGAAAATCAGCTCGCCATGCTGTCGCCGCAATAATGGAACCCGACACAACAC
CAGAATTCGATTACTTGCCGTTCTTCTATTCCAGAGTTTTCTCATTTTCGTGGCAGTTCTACGGAGACAATTTAGGGGAAGTCATTTATTTCGGTGATTTTTCGGGACCCAGTTTCGGCG
CGTACTGGGTGCACAAAGGTCATCTAGTTGGATCGTTTCTTGAAGGCGGAAGTAAAGAAGAGTATGAAGCGATAGCGAAAGTGACGAGGCTTAAACCAGCTGTTGATGATTTGAGTGAGC
TCGAGCGGCAGGGTCTCGGGTTCGTGGTGGCGTTGAGCGAGAAGTTGCCGGTGGCGCCGGTGATAAACGTGGGTGGTTCGATGTCGACGGTTGTTTTGGAGAAACCGTTGTACGCGTGGC
ATGCGACTGCTGGGGTGGTGGTGGCGGCGTCGATAGCGGCGTTTGCGTATTGGTATGGAAGAAGACGTCGACGATGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGAGCGTTTGTGTATGTGATACTTGGTGGGGGAGTTGCTGCCGGTTATGCAGCTCTTGAATTCACCAAAAAAGGTGTTTCTCACGGTGAACTCTGCATCATCTCCGAAGAACCT
GTGGCTCCTTACGAGAGACCCGCACTCAGCAAAGGCTTTCTACTTCCAGAAGCTCCGGCACGTCTTCCCGCATTTCACACTTGTGTCGGTGCCAATGAAGAAAGATTAACGCCGAAGTGG
TACAAGGAACATG
GAATCGAACTGATTCTGGGTACGCGCGTAAAGTCTGCTGACGTGAGGCGTAAAACATTACTCACTGCAGCAGGAGAAACCATTAGCTATAAGTATCTTATCATTGCA
ACAGGTGCTCGG
GCTTTGAGACTTGAAGAGTTCGGTGTAAGTGGATCAGATGCTGAAAATGTATGTTATCTACGTGATTTGGCTGACGCAACCAGGCTTGCGGACGTGATGCAAACCTCT
ACTGGCGGCAATGCGGTGGTCATTGGCGGTGGCTACATTGGAATGGAGGTTGCGGCGTCGTTGGTCATTAATAAGATTAATGTTTCAATGGTGTTCCCTGAGCCACATTGCA
TGGGCCGT
TTATTCACCCCCAAGATTGCAAGTTATTATGAAGAGTTTTATAAAGCTAAGGGTGTAAACTTTGTCAAAGGCACAGTTCTGTCATCATTTGTTTTCGATGAAGATGGGAAG
GTCACCGGA
GTTAACCTCAAGGATGGAACCGATCTTCCTGCTGACTTGGTAGTCGTCGGAATCGGAATCCGACCAAACACAAGTCTATTTGAAGGGCAACTCACTTTAGAAAAAGGCGGGATCAAAGTT
AACAGCAGGTTGCAAACGAGCAACAGCTCTGTGTACGCAGTAGGTGACGTGGCATCGTTTCCAGTCAAGATCTTTGGCGAAAGCCGACGACTCGAACACGTCGATGCCGCCAGAAAATCA
GCTCGCCATGCTGTCGCCGCAATAATGGAACCCGACACAACACCAGAATTCGATTACTTGCCGTTCTTCTATTCCAGAGTTTTCTCATTTTCGTGGCAGTTCTACGGAGACAATTTAGGG
GAAGTCATTTATTTCGGTGATTTTTCGGGACCCAGTTTCGGCGCGTACTGGGTGCACAAAGGTCATCTAGTTGGATCGTTTCTTGAAGGCGGAAGTAAAGAAGAGTATGAAGCGATAGCG
AAAGTGACGAGGCTTAAACCAGCTGTTGATGATTTGAGTGAGCTCGAGCGGCAGGGTCTCGGGTTCGTGGTGGCGTTGAGCGAGAAGTTGCCGGTGGCGCCGGTGATAAACGTGGGTGGT
TCGATGTCGACGGTTGTTTTGGAGAAACCGTTGTACGCGTGGCATGCGACTGCTGGGGTGGTGGTGGCGGCGTCGATAGCGGCGTTTGCGTATTGGTATGGAAGAAGACGTCGACGATGG
TGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CATTTACTTT TGCCCCATTT TATTATCATG CGGAATATTG TAGAGAGAGA AAGAGTGATG AACAAACAAT AGTTTTAGAG AGAGAAACCC AGAAATAGAT AAACAATTTG AAATGGGAAG  AGCGTTTGTG TATGTGATAC TTGGTGGGGG AGTTGCTGCC GGTTATGCAG CTCTTGAATT CACCAAAAAA GGTGTTTCTC ACGGTGAACT CTGCATCATC TCCGAAGAAC CTGTGGCTCC  TTACGAGAGA CCCGCACTCA GCAAAGGCTT TCTACTTCCA GAAGCTCCGG CACGTCTTCC CGCATTTCAC ACTTGTGTCG GTGCCAATGA AGAAAGATTA ACGCCGAAGT GGTACAAGGA  ACATGGAATC GAACTGATTC TGGGTACGCG CGTAAAGTCT GCTGACGTGA GGCGTAAAAC ATTACTCACT GCAGCAGGAG AAACCATTAG CTATAAGTAT CTTATCATTG CAACAGGTGC  TCGGGCTTTG AGACTTGAAG AGTTCGGTGT AAGTGGATCA GATGCTGAAA ATGTATGTTA TCTACGTGAT TTGGCTGACG CAACCAGGCT TGCGGACGTG ATGCAAACCT CTACTGGCGG  CAATGCGGTG GTCATTGGCG GTGGCTACAT TGGAATGGAG GTTGCGGCGT CGTTGGTCAT TAATAAGATT AATGTTTCAA TGGTGTTCCC TGAGCCACAT TGCATGGGCC GTTTATTCAC  CCCCAAGATT GCAAGTTATT ATGAAGAGTT TTATAAAGCT AAGGGTGTAA ACTTTGTCAA AGGCACAGTT CTGTCATCAT TTGTTTTCGA TGAAGATGGG AAGGTCACCG GAGTTAACCT  CAAGGATGGA ACCGATCTTC CTGCTGACTT GGTAGTCGTC GGAATCGGAA TCCGACCAAA CACAAGTCTA TTTGAAGGGC AACTCACTTT AGAAAAAGGC GGGATCAAAG TTAACAGCAG  GTTGCAAACG AGCAACAGCT CTGTGTACGC AGTAGGTGAC GTGGCATCGT TTCCAGTCAA GATCTTTGGC GAAAGCCGAC GACTCGAACA CGTCGATGCC GCCAGAAAAT CAGCTCGCCA  TGCTGTCGCC GCAATAATGG AACCCGACAC AACACCAGAA TTCGATTACT TGCCGTTCTT CTATTCCAGA GTTTTCTCAT TTTCGTGGCA GTTCTACGGA GACAATTTAG GGGAAGTCAT  TTATTTCGGT GATTTTTCGG GACCCAGTTT CGGCGCGTAC TGGGTGCACA AAGGTCATCT AGTTGGATCG TTTCTTGAAG GCGGAAGTAA AGAAGAGTAT GAAGCGATAG CGAAAGTGAC  GAGGCTTAAA CCAGCTGTTG ATGATTTGAG TGAGCTCGAG CGGCAGGGTC TCGGGTTCGT GGTGGCGTTG AGCGAGAAGT TGCCGGTGGC GCCGGTGATA AACGTGGGTG GTTCGATGTC  GACGGTTGTT TTGGAGAAAC CGTTGTACGC GTGGCATGCG ACTGCTGGGG TGGTGGTGGC GGCGTCGATA GCGGCGTTTG CGTATTGGTA TGGAAGAAGA CGTCGACGAT GGTGAGGGTT  ATGGGTTGGT GGGGGATTTG TTTGCATTGA TTCCACTATT TGATACCTTT ACCCATGTTG TGCAATTTGA TTAGGAGGTT TGAAGAACAA GAACACTCAT GTAATAGATT GATAAGCTAC  ATAACATCAT CAATATTCTA TATTATTATG TATAACATGT GTCTAGATAA AAAGTTATAT GTTTCTTTAA AATCATGCAA CTTCTTTTTG TTGATTTTCT TTAATTACAT GAAAAGATCA 
AGAAAGTCAA AACCACAAGT ATGCAAAGAA AACAACAATC AAGAATTTTC 

Retrieve as FASTA