Entry information : HaGrxC01(HanXRQChr03g0074941)
Entry ID 14405
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-02-03 (Catherine )
Peroxidase information: HaGrxC01(HanXRQChr03g0074941)
Name HaGrxC01(HanXRQChr03g0074941)
Class CGYC Grx    [Orthogroup: GrxC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC01
start..stop
S start..stop
HaGrxC17 198 2e-68 1..97 1..97
HaGrxC04 196 1e-67 1..97 1..97
HaGrxC19 196 2e-67 1..97 1..97
HaGrxC11 184 1e-62 9..97 5..93
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 104085587..104085606 20 N° 2 104085670..104085758 89 N° 3 104085852..104085950 99 N° 4 104086031..104086116 86
join(104085587..104085606,104085670..104085758,104085852..104085950,104086031..1 04086116)


exon

Literature and cross-references HaGrxC01(HanXRQChr03g0074941)
Protein sequence: HaGrxC01(HanXRQChr03g0074941)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   97
PWM (Da):   %s   10386.23  
PI (pH):   %s   6.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQSYLSCKTWCGYCKSVKKLFSELNVSYKVIELDESDGGEIQSTLKEWTGQSIVPNVFIGGKHIGGSDAIMEKHRAGKLVPLLTEAGAIANASAQL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCTATCTTTCTTGGTTTGTCTTGATGAATGATGTTGTGCGATTAGGAACTAAGAAATTTTAACTTGATTTTGGCAGCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAA
CTGTTCTCCGAGCTTAACGTGTCCTATAAGGTTATCGAACTGGATGAAGAAA
GTAAGTAGTGACTTTTGACTCTTTCGAGGAATTGATTCATATCGGAGTTTGTATCAATAACATTTGAA
GAAGTAATATGCATGGATTTGATAGGTGATGGAGGTGAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCG
GATG
GTAAGTTGTTTGAGCAATTTTGTGTCTGTTTTTTAGTGTTTGTTGATCGCGGATGATTGATATTGTGGTCTTTTATGCAGCTATTATGGAGAAGCATCGAGCTGGGAAGCTGGTGC
CGTTGCTAACCGAAGCAGGTGCCATTGCGAATGCCTCTGCACAGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCTATCTTTCTTGCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAACTGTTCTCCGAGCTTAACGTGTCCTATAAGGTTATCGAACTGGATGAAGAAAGTGATGGAGGT
GAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATG
CTATTATGGAGAAGCATCGAGCTGGGAAGCTG
GTGCCGTTGCTAACCGAAGCAGGTGCCATTGCGAATGCCTCTGCACAGCTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCT ATCTTTCTTG CAAGACTTGG TGTGGCTATT GCAAGAGCGT GAAGAAACTG TTCTCCGAGC TTAACGTGTC CTATAAGGTT ATCGAACTGG ATGAAGAAAG TGATGGAGGT  GAAATCCAAT CCACTCTAAA GGAGTGGACC GGTCAGAGTA TTGTTCCTAA TGTATTCATA GGTGGGAAGC ACATTGGTGG CTCGGATGCT ATTATGGAGA AGCATCGAGC TGGGAAGCTG 
GTGCCGTTGC TAACCGAAGC AGGTGCCATT GCGAATGCCT CTGCACAGCT CTGA 

Retrieve as FASTA