Entry information : HaGrxC02 (HanXRQChr03g0086071)
Entry ID 14406
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC02 (HanXRQChr03g0086071)
Name (synonym) HaGrxC02 (HanXRQChr03g0086071)
Class CGYC Grx    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC02
start..stop
S start..stop
HaGrxC04 85 4e-23 73..112 8..47
HaGrxC19 84 4e-23 73..112 8..47
HaGrxC01 84 5e-23 73..112 8..47
HaGrxC17 84 5e-23 73..112 8..47
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 145306527..145306529 3 N° 2 145305636..145305847 212 N° 3 145305276..145305364 89 N° 4 145305149..145305183 35
complement(join(145305149..145305183,145305276..145305364,145305636..145305847,1 45306527..145306529))


exon

Literature and cross-references HaGrxC02 (HanXRQChr03g0086071)
DNA ref. HanXRQ genome:   HanXRQChr03 (145306529..145305149)
Protein sequence: HaGrxC02 (HanXRQChr03g0086071)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   112
PWM (Da):   %s   12680.28  
PI (pH):   %s   4.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSMKGWRNKVNDYNLYFVLGDLWESLKEWSAYGAGVPLVLNESDSVVEYNVPYLSDIQLYVDPTTPLTKRSKTWCGYCKSVKKLFSELNVSYKVIELDESDGGEIQSTLK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTGATGATGGAGGAGTTGCATGTTTTTTATGTGTTTTTTGATGATTGGTTACATGGGTAGTTATAAAAATGTGATTTTTTTTTGGGTTTTGGTTATTGGTAGGCATTAAAATGTA
TCAAAACAAGATTCAAGAAAAAAATAAAAACTTTGATAATGAAGAAATTGCAAGTTGGTTTTGTGTTTTTTGATGATTGGTTACACGAGTAATTATAAAAATGTGATTTTTTATAGTTTT
GATTATTGGTAGTCATTAAAATGTATTAAAACAAGATTCAAGAAAAAATAAAAACTTTGATAATGAAGAAATTGCAAGTTGTTTATGTGTGTTTTTGTCATGGGTCGTTAACAAAATTTG
TACTGTATGAATTTGACTGGATTAGGAAACAATGCATGTTTTTGAGTAATAATTGATCATTGTGGTTCATTATGTATTGTCAATGATTTTGCATGTGATGTGTTAGCTCTACTAGAAAGT
TAACATTAGTTTACTAATTCAGCATCTGATGCTGTGAAATTAGATGATGCTAAAGTTGCATACAAGTAAAGTAGCGATTATATTAGTGTTCAAGATACTTGAATGTGGCTATTGATAATG
CATTAACACTTATGATTAAGTTTGTTGAGTGGCATAAAAACACGATCTTATTGGTGATTTATTTGATATATCATATATGTAGACTAGCATGAAGGGATGGAGGAATAAAGTAAACGATTA
CAACCTATATTTTGTACTTGGGGATCTTTGGGAGTCTTTAAAGGAATGGAGTGCATATGGAGCTGGAGTTCCTCTTGTGTTGAATGAAAGTGATTCAGTTGTTGAATACAATGTTCCTTA
TTTGTCCGACATTCAACTTTATGTAGATCCGACAACACCCCTAACCAAAAGAAG
GTGAGTATTATAATTTTTATTTACTAACAAGCGTTTTCGATTAGTTTTTGCTGAATGATGTTATGT
TTATCATAGATTTATAGCTAATCTCTCGGATCGGCAATTAGGAATTTAACTTGATTCCTAATAACAAGTGTTACTGTAAGAACAGTTAAGTTCCTTTTTCACGACAAATCGTGAAAGTAT
AGATGCAAAGCTATCTTTCTTGGTTTGTCTTGATGAATGATGTTGTGCGATTAAGAACTAAGAAATTTTAACTTGATTTTGGCAGCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGA
AACTGTTCTCCGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGAAGAAA
GTAAGTAGTGACTTTTGACTCTATTGATGAATTGATTCATATCAGAGTTTGTATCAATAACATTTG
AAGAAGTAATATGCATGATTTGATAGGTGATGGAGGTGAAATCCAATCCACTCTAAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTAGCATGAAGGGATGGAGGAATAAAGTAAACGATTACAACCTATATTTTGTACTTGGGGATCTTTGGGAGTCTTTAAAGGAATGGAGTGCATATGGAGCTGGAGTTCCTCTTGTG
TTGAATGAAAGTGATTCAGTTGTTGAATACAATGTTCCTTATTTGTCCGACATTCAACTTTATGTAGATCCGACAACACCCCTAACCAAAAGAAG
CAAGACTTGGTGTGGCTATTGCAAG
AGCGTGAAGAAACTGTTCTCCGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGAAGAAA
GTGATGGAGGTGAAATCCAATCCACTCTAAAGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGAATTGTC TTAGAAAGTG GCTGCCTACC AGGTGGTCTA CGTTGCCTCT TAAACGGGTC AGAACTGTCT AAGAAAGTGG TTGCCTACCT GGTGTTTGAT CAGTTGCCTC CAATTCAGCT  CTTTTTATGG CTGATTACAC TCACATTGTG TTTCTCTACA CAATCAATGT GATGTGTTTT TGGTGTTCTT TTTCATTTTC TTCAGGTCTT CCTAAACAAT CAATGTGATG TGTAGGTAGG  GTGTTCAATT AACACACGAC TCCAGTTGTG ACTTAAACCG CATTTCCCTA AGGTATTGTT ACAAGTTTTA AGTTAAAATG ACTAGCATGA AGGGATGGAG GAATAAAGTA AACGATTACA  ACCTATATTT TGTACTTGGG GATCTTTGGG AGTCTTTAAA GGAATGGAGT GCATATGGAG CTGGAGTTCC TCTTGTGTTG AATGAAAGTG ATTCAGTTGT TGAATACAAT GTTCCTTATT  TGTCCGACAT TCAACTTTAT GTAGATCCGA CAACACCCCT AACCAAAAGA AGCAAGACTT GGTGTGGCTA TTGCAAGAGC GTGAAGAAAC TGTTCTCCGA GCTTAACGTG TCCTACAAGG  TTATCGAACT GGATGAAGAA AGTGATGGAG GTGAAATCCA ATCCACTCTA AAGTAGTGGA CCGGTCAGAG TATTGTTCCT AATATATTCA TAGGTGGGAA GCACATTGGT GGCTCGGATG  CTATTATGGA GAAGCATCGA GCTGAAAAGC TGGTGCCGTT GCTAACCGAA GCAGGTGCCA TTGCGAATGC CTCTGCACAG CTCTGAAGAT TGGTGTCATG AATAAGATGA TTAAGTTGGA  TGAGTACGGT ATCGGTACCG AAATTCGCCA AATATGGATA CCGGTACCGA ATATGTACGG TACGGTACCG GTATTTAAAA GTTTAAGTCA ACATTTCTAA GTAGTATAAT TTATTGTAAG 
ACCACCCGTG TAGCACACGG GAACTTAGAC TAGATATGAT ATTTATTCGC TCTTTTAGTG AACAGGCTTA ATTTCTTCAA TTAAA 

Retrieve as FASTA