Entry information : HaGrxC03 (HanXRQChr05g0142181)
Entry ID 14407
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC03 (HanXRQChr05g0142181)
Name (synonym) HaGrxC03 (HanXRQChr05g0142181)
Class CGYC Grx    [Orthogroup: GrxC005]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC03
start..stop
S start..stop
AtGrxC04 181 2e-60 1..129 3..131
ThasGrxC04 170 2e-56 32..132 32..133
MpalGrxC01 168 3e-55 14..123 27..136
MpGrxC01 162 7e-53 13..123 27..137
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 102587987..102588138 152 N° 2 102588279..102588352 74 N° 3 102589657..102589755 99 N° 4 102589850..102589923 74
join(102587987..102588138,102588279..102588352,102589657..102589755,102589850..1 02589923)


exon

Literature and cross-references HaGrxC03 (HanXRQChr05g0142181)
DNA ref. HanXRQ genome:   HanXRQChr05 (102587987..102589923)
Protein sequence: HaGrxC03 (HanXRQChr05g0142181)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   132 (110)
PWM (Da):   %s   14351.44 (12042.1) Transmb domain:   %s   i5-22o
PI (pH):   %s   7.51 (7.51) Peptide Signal:   %s   cut: 28 range:23-132
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTVTISSVFIILLTIATVFTSNTEASSVDFVKKTVSSHPIVIFSKSYCPYCKRAKGVFKELNVKPYVLELDEEDGSKIQDALSEMVGRRTVPQVFINGKHLGGSDDTVEAYQSGELAKLLGIESHKTDL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGCACCGTCACCATTTCTTCCGTTTTCATCATCCTCTTAACCATTGCCACCGTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAACTGTCTCTTCTCAC
CCCATTGTCATCTTCTCCAAATCCTACTGTCC
GTACGTATTTTTCATTTCTATCAAATTGTTTGATATACCTACCTACCACTGTTTAATTAATTATTATTAAAGATTTATGAAATTGTTG
GTATAAATGTTTGAAATTGTTGTTGTGTTGATGATTTGTTTGTTGTTGGTAGGTATTGTAAAAGGGCAAAAGGTGTATTCAAGGAGTTGAATGTGAAACCTTATGTACTCGAGCTCGATG
AGAGAG
GTGAATACTTTTGGATTCTTATATTTATTATTGCTAAACAATTATTTGGTATAAGTTTAGCAACGATTTGGATGATGCGAATTGCTTAACTGATTCTGCTCAGGGGCGAAGTAT
AGAAGGGGCGGGAGGGGGCGCCCGACCCCCGAACTTTTCGCTCAGTAGTGTTATATATATAGTTTTCAGATAGAAATTTTTGGGTATATATCTTTTTGACCCCCGACCCCCCGGTTCTAT
AGAAATTTTTTGGTATATACGTTTTCGCCCACCCCCCTCCCCTGCGCGTCATTCGGGTCAAGCTTCGCCACTGATTCTGCTAGATGGGTTGTGTTAGATTAAAATGGGAAAATAGAATCG
GTGCACGAAAAGTGTTAAGTGCATCACTGTTTTTATGTCAATGACTAACATGAGAATTCAACTTTAAATCATAAACCCTAACAAAGACTTTGTTAAGGATTGGTAAATGATAAGCTTGGC
CTTGTGATTGTTGAAGACATAGTTTGCTAATGCTAACATTCCTTTTATCAAAGTATTATTTTTCTTTCATATTTTTAATTACAGCGAATGATAAGTTTGATCTTGTGATTTTCGACGCTA
ACATTTCTTCTACAAAAAGGGTAAAATTTTATCAAAAACATCTACGTCGACATTGGTTAAGGTCGACAAATTATGAATTTATGATATCCATCCACATAAAACAAGATTACCAAAGTATAG
TCTTTATCTGTTTTCTTGGACTAATTTGCATGACCGTATTTGTTTTCGATATTATTGTTTGGTTTATATAGAACATGTTAGTAAAGGTTGTTTGTTATAATTATTTTAGAGTAAACTGCC
AAAATGGTCCCTGAGGTTTGGTCACTTTTGCCACATTAGTCCAAAACTCAAACCTTTTGAATCTGGGTTCCCGTGGTTTCAGTTTTGTTGCCATTTTCATCCAAAATCAAAATATAATCA
GATTTTTCAGTTAACATCCAGCTTTTCTATCTTTTTCCTCTCTTTTAACGAAGGACAAAATGGTCTTTTAACGTTTTATCATAACAAATTAAAAAAATCTAACATTTTGCCCTTCGTTAA
AAGGGAGGAAAAAGACAGAAAAGCTGGATGTTAACTGAAAAATCTGATTATATTTTGATTTTGGATGAAAATGGCATCAAAATTGAAACCACATGGACCCAGATTCAAAAGGTTTGAGTT
TTGGACTAAAGTGACCAAACCTCAAGGACCATTTTGGTAGTTTACTCTTTATTTTAAGATTGTGGGATTTTCGTTATTTTAAAATTTATGGGATGTACTTCGTTTTGCAGAGGACGGGTC
GAAAATTCAGGATGCATTGAGTGAGATGGTTGGGAGGCGTACTGTTCCACAAGTGTTTATCAATGGGAAACACCTCGGAGGTTCGGATG
GTAAGTTAAACATCAAGCAACTCTAACCACA
TTTTTGTTGCTACAATCACATGTTAGCTTAATAAACTTTTTGTCTATTGGTCTGTATCTATAGATACTGTTGAAGCTTATCAGAGTGGAGAATTGGCAAAGCTTCTTGGCATTGAGAGTC
ATAAAACGGACCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGCACCGTCACCATTTCTTCCGTTTTCATCATCCTCTTAACCATTGCCACCGTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAACTGTCTCTTCTCAC
CCCATTGTCATCTTCTCCAAATCCTACTGTCC
GTATTGTAAAAGGGCAAAAGGTGTATTCAAGGAGTTGAATGTGAAACCTTATGTACTCGAGCTCGATGAGAGAGAGGACGGGTCGAAA
ATTCAGGATGCATTGAGTGAGATGGTTGGGAGGCGTACTGTTCCACAAGTGTTTATCAATGGGAAACACCTCGGAGGTTCGGATG
ATACTGTTGAAGCTTATCAGAGTGGAGAATTGGCA
AAGCTTCTTGGCATTGAGAGTCATAAAACGGACCTTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAAACCTAAA CCATCAAAGC CTTAAAAATA AACCATAGAC TTTCCATTCT AGACATGTGG CTTCCTTGAC GGAGTCATAG AATATAGGGT TTAAATCAAG CTGAAATTCA GATCTAAATT  TGACGCCGAC AGTTGTACCA AAAACCGCTA TCACCGTCGC AAAATGGCCA GCACCGTCAC CATTTCTTCC GTTTTCATCA TCCTCTTAAC CATTGCCACC GTCTTCACAT CCAATACCGA  AGCATCATCC GTCGATTTCG TCAAGAAAAC TGTCTCTTCT CACCCCATTG TCATCTTCTC CAAATCCTAC TGTCCGTATT GTAAAAGGGC AAAAGGTGTA TTCAAGGAGT TGAATGTGAA  ACCTTATGTA CTCGAGCTCG ATGAGAGAGA GGACGGGTCG AAAATTCAGG ATGCATTGAG TGAGATGGTT GGGAGGCGTA CTGTTCCACA AGTGTTTATC AATGGGAAAC ACCTCGGAGG  TTCGGATGAT ACTGTTGAAG CTTATCAGAG TGGAGAATTG GCAAAGCTTC TTGGCATTGA GAGTCATAAA ACGGACCTTT GAGCTTCAAG CCTTAGACAG CCTAATAATG CCGTAATTTG  TACGAATGTT GGTAGTTTAA GTTGACTTGA GTTTACGATT ATGTCAAAAT ATGTACCAAT AAATTTGGAT ATGATACCGT TTGTATTACA TATTCGGCCT ATTACCTCTC TATATACCGA  TAAAGTAGAC TTGAGGAACC TTGGTGTCTC GTTATGGTCA CGCGTCAGAT TAAAACCGAA CGGTACCAAA AATATAACCG AAAATTTGAA GTGTGGGTTT CATAAAAGTT TAGAAACTCT 
GGTTTAAAAA ACTGGCTTTA ATGGTCTAGA TGCAGTTATA CATATGTACA GTATTTAT 

Retrieve as FASTA