Entry information : HaGrxC04(HanXRQChr05g0145251)
Entry ID 14408
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-02-03 (Catherine )
Peroxidase information: HaGrxC04(HanXRQChr05g0145251)
Name HaGrxC04(HanXRQChr05g0145251)
Class CGYC Grx    [Orthogroup: GrxC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC04
start..stop
S start..stop
HaGrxC01 196 1e-67 1..97 1..97
HaGrxC17 194 5e-67 1..97 1..97
HaGrxC19 192 7e-66 1..97 1..97
HaGrxC11 180 3e-61 9..97 5..93
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 129226785..129226804 20 N° 2 129226868..129226956 89 N° 3 129227050..129227148 99 N° 4 129227230..129227315 86
join(129226785..129226804,129226868..129226956,129227050..129227148,129227230..1 29227315)


exon

Literature and cross-references HaGrxC04(HanXRQChr05g0145251)
Protein sequence: HaGrxC04(HanXRQChr05g0145251)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   97
PWM (Da):   %s   10402.26  
PI (pH):   %s   6.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQSYLSCKTWCGYCKSVKKLFSELNVSYKVIELDESDGGEIQSTLKEWTGQSIVPNVFIGGKHIGGSDAIMEKHRAGKLVLLLTEAGAIANASAQL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCTATCTTTCTTGGTTTGTCTTGATGAATGATGCTGTGTGATTAGGAACTAAGAAATTTTAACTTGATTTTGGCAGCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAA
CTGTTCTCCGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGAAGAAA
GTAAGTAGTGACTTTTGACTCTTTCGATGAATTGATTCATATCGGAGTTTGTATCAATAACATTTGAA
GAAGTAATATGCATGGATTTGATAGGTGATGGAGGTGAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCG
GATG
GTAAGTTGTTTGAGAAATTTTGTGTCTGTTTTTTAGTGTTTGTTGATCGCGGATTGATTGATATTGTGGTCTTTTATGCAGCTATTATGGAGAAGCATCGAGCTGGGAAGCTGGTG
CTTTTGCTAACCGAAGCAGGTGCCATTGCGAATGCCTCTGCACAGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCTATCTTTCTTGCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAACTGTTCTCCGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGAAGAAAGTGATGGAGGT
GAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATG
CTATTATGGAGAAGCATCGAGCTGGGAAGCTG
GTGCTTTTGCTAACCGAAGCAGGTGCCATTGCGAATGCCTCTGCACAGCTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCT ATCTTTCTTG CAAGACTTGG TGTGGCTATT GCAAGAGCGT GAAGAAACTG TTCTCCGAGC TTAACGTGTC CTACAAGGTT ATCGAACTGG ATGAAGAAAG TGATGGAGGT  GAAATCCAAT CCACTCTAAA GGAGTGGACC GGTCAGAGTA TTGTTCCTAA TGTATTCATA GGTGGGAAGC ACATTGGTGG CTCGGATGCT ATTATGGAGA AGCATCGAGC TGGGAAGCTG 
GTGCTTTTGC TAACCGAAGC AGGTGCCATT GCGAATGCCT CTGCACAGCT CTGA 

Retrieve as FASTA