Entry information : HaGrxC05 (HanXRQChr06g0166961)
Entry ID 14409
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC05 (HanXRQChr06g0166961)
Name (synonym) HaGrxC05 (HanXRQChr06g0166961)
Class CGYC Grx    [Orthogroup: GrxC003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC05
start..stop
S start..stop
HaGrxC26 188 2e-64 1..95 1..95
HaGrxC22 188 2e-64 1..95 1..95
HaGrxC15 188 2e-64 1..95 1..95
HaGrxC07-1E 188 2e-64 1..95 1..95
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6984431..6984573 143 N° 2 6984143..6984287 145  
complement(join(6984143..6984287,6984431..6984573))


exon

Literature and cross-references HaGrxC05 (HanXRQChr06g0166961)
DNA ref. HanXRQ genome:   HanXRQChr06 (6984573..6984143)
Protein sequence: HaGrxC05 (HanXRQChr06g0166961)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   95 (71)
PWM (Da):   %s   10762.75 (8152.5) Transmb domain:   %s   i7-24o75-94i
PI (pH):   %s   9.07 (9.52) Peptide Signal:   %s   cut: 25 range:25-95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTSSSIFILFFTIATLFTSNTEASSVDFVKKIVSSHSIVIFSKSYYPYCKRAKGVFKELNAKPYVLELDERGEWFWILLFALLVIALVLNNFLI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCAGTTCTTCCATTTTCATCCTCTTCTTCACCATTGCCACCCTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAATAGTCTCTTCTCACTCCATAGTC
ATCTTCTCCAAATCTTACTATCC
GTACGTATTTTTCATTTCATATGATATCCCTATCAGTTCCGCATTCGTTTAATTGTGTATTAAGAAATTATTTATATTTTTGATTTGTTTATTATTG
GTATAAATGTTTGAAAATGTTTTTTTAATATTGTGTTGATCATCAGGTATTGTAAAAGGGCTAAAGGTGTATTCAAGGAGTTGAATGCGAAACCGTATGTACTCGAGCTCGATGAGAGAG
GTGAATGGTTTTGGATTCTTTTATTTGCACTTCTTGTTATTGCTCTTGTGCTAAATAATTTCTTAATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCAGTTCTTCCATTTTCATCCTCTTCTTCACCATTGCCACCCTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAATAGTCTCTTCTCACTCCATAGTC
ATCTTCTCCAAATCTTACTATCC
GTATTGTAAAAGGGCTAAAGGTGTATTCAAGGAGTTGAATGCGAAACCGTATGTACTCGAGCTCGATGAGAGAGGTGAATGGTTTTGGATTCTTTTA
TTTGCACTTCTTGTTATTGCTCTTGTGCTAAATAATTTCTTAATTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCA GTTCTTCCAT TTTCATCCTC TTCTTCACCA TTGCCACCCT CTTCACATCC AATACCGAAG CATCATCCGT CGATTTCGTC AAGAAAATAG TCTCTTCTCA CTCCATAGTC  ATCTTCTCCA AATCTTACTA TCCGTATTGT AAAAGGGCTA AAGGTGTATT CAAGGAGTTG AATGCGAAAC CGTATGTACT CGAGCTCGAT GAGAGAGGTG AATGGTTTTG GATTCTTTTA 
TTTGCACTTC TTGTTATTGC TCTTGTGCTA AATAATTTCT TAATTTGA 

Retrieve as FASTA