Entry information : HaGrxC06 (HanXRQChr06g0173301)
Entry ID 14410
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC06 (HanXRQChr06g0173301)
Name (synonym) HaGrxC06 (HanXRQChr06g0173301)
Class CGYC Grx    [Orthogroup: GrxC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC06
start..stop
S start..stop
HaGrxC01 180 3e-61 4..93 8..97
HaGrxC11 179 8e-61 1..93 1..93
HaGrxC17 178 1e-60 4..93 8..97
HaGrxC04 176 8e-60 4..93 8..97
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26765069..26765076 8 N° 2 26764939..26765027 89 N° 3 26764747..26764845 99 N° 4 26764586..26764671 86
complement(join(26764586..26764671,26764747..26764845,26764939..26765027,2676506 9..26765076))


exon

Literature and cross-references HaGrxC06 (HanXRQChr06g0173301)
DNA ref. HanXRQ genome:   HanXRQChr06 (26765076..26764586)
Protein sequence: HaGrxC06 (HanXRQChr06g0173301)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   93
PWM (Da):   %s   9898.04  
PI (pH):   %s   7.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMFKTWCGYCKSVKKLFSELNVSYKVIELDGSDGGEIQSTLKEWTGQSIVPNVFIGGKHIGGSDAIMEKHRAGKLVPLLTEAGAIATASAQL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTGTGTGATTAGGAACTAAGAAATTTTAACTTGATTTTGGCAGCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAACTGTTCTCCGAGCTTAACGTGTCCTACAAGGTTA
TCGAACTGGATGGAGAAA
GTAAGTAGTGACTTTTGACTCTTTCGATGAATTGATTCATATCGGAGTTTGTATCAATAACATTTCAAGAAGTAATATGCATGGATTTGATAGGTGATGGAG
GTGAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATG
GTAAGTTGTTTGAGCAATTTTGTGTCTGTT
TTTGGGTGTTTGTCGGATTGATTGATATTGTGGTATTTTATGCAGCTATTATGGAGAAGCATCGAGCTGGGAAGCTGGTGCCGTTGCTAACTGAAGCAGGTGCCATTGCGACTGCCTCTG
CACAGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAACTGTTCTCCGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGGAGAAAGTGATGGAGGTGAAATCCAATCC
ACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATG
CTATTATGGAGAAGCATCGAGCTGGGAAGCTGGTGCCGTTGCTA
ACTGAAGCAGGTGCCATTGCGACTGCCTCTGCACAGCTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTCA AGACTTGGTG TGGCTATTGC AAGAGCGTGA AGAAACTGTT CTCCGAGCTT AACGTGTCCT ACAAGGTTAT CGAACTGGAT GGAGAAAGTG ATGGAGGTGA AATCCAATCC  ACTCTAAAGG AGTGGACCGG TCAGAGTATT GTTCCTAATG TATTCATAGG TGGGAAGCAC ATTGGTGGCT CGGATGCTAT TATGGAGAAG CATCGAGCTG GGAAGCTGGT GCCGTTGCTA 
ACTGAAGCAG GTGCCATTGC GACTGCCTCT GCACAGCTCT GA 

Retrieve as FASTA