Entry information : HaGrxC08 (HanXRQChr07g0191291)
Entry ID 14412
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC08 (HanXRQChr07g0191291)
Name (synonym) HaGrxC08 (HanXRQChr07g0191291)
Class CGYC Grx    [Orthogroup: GrxC006]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC08
start..stop
S start..stop
HaGrxC21 175 1e-57 5..137 37..167
AtGrxC03 133 1e-41 24..139 13..129
ThasGrxC03-2 120 3e-36 46..139 39..132
MpGrxC01 119 1e-35 37..139 36..139
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34925021..34925214 194 N° 2 34924016..34924089 74 N° 3 34923800..34923898 99 N° 4 34923657..34923712 56
complement(join(34923657..34923712,34923800..34923898,34924016..34924089,3492502 1..34925214))


exon

Literature and cross-references HaGrxC08 (HanXRQChr07g0191291)
DNA ref. HanXRQ genome:   HanXRQChr07 (34925214..34923657)
Protein sequence: HaGrxC08 (HanXRQChr07g0191291)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   140
PWM (Da):   %s   15526.04 Transmb domain:   %s   i13-35o
PI (pH):   %s   9.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTKTMEFRSNNIRKSGILPLGITLLLMMMMFAPTKVVGSMSPSAFFENLIYSNRIVIFSKTQCPYCVVAKSVFNRLKEQPYVVELDHEDGGRIQEVLFDRVGRRTVPQVFVNGQHIGGADDLDVAVKNGALQGLLCTC

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACGAAGACAATGGAGTTCCGATCAAATAATATCCGTAAATCCGGGATCTTACCGCTCGGAATCACGCTGTTGTTGATGATGATGATGTTTGCACCTACGAAAGTCGTAGGTTCG
ATGTCTCCGTCGGCTTTTTTTGAGAACCTTATCTACTCCAACAGGATCGTAATTTTCTCCAAAACCCAATGCCC
GTTAGTATTCTTTCAATCGATTTTTATAACATTCATGTTGTTTCTT
AATTCTGCGAATATTTTTTAGGAAATTTAATATTCCTTGTGATGTTTGTGTTGGTTAGAATACTTTTGATCCTGTTTTGATCGATGATTGTTTTCTTGTGGCCATTGGCGGAGCCACATT
GTGGTAAAGTATGGTAAGAAAAGAGATTCAAGCCACAACATTGTTTTTTATATACGTTTTAGACAATAAAAAATATAATTTAAAAGTAAGCCCAATTACTTGATTTTAAAAGTAAGCCCA
ATTTAATTTTAATAGTGGATTTTAAATCATTAGAGGACCATGTCTAATTTTTTAAACTTTAATTCAAATAATCATTATAGCTCATGTTCAATTAATTTATTTCATTTTCTTAACCTATAT
CAGAAAAAAAAGACCCGACGCGAAAAAATTGAGTCTGGGTTATCACAAAACCGGGTATCAAAAAAATGATACCAAAGGAAAAACGTTCTGGCTCCGCCACTGCTTGTGGCCCAATTTAAT
TAAACCTAATTTTGTTTCAATGTATACCCCATGTCTGTCATGTATTGTAATCTTTGTACTAAGCATAATAAAATATCTAGTTGCAGTCTATAGACGTAGGATTCACATTGAATCCGAACC
ACGTAAATTTTCGTGTTCTTGCTTTTATTTTTCTATTATGCGTTTGTGCATTGTATACAATCCTCCGTTAAAAGTTATTAACCGATTGCATATTCATATTTAACATGTTAATGGTTTCCA
AGATTGATCACTAAGACATCATAAGCTAGCACACCATGCTTAATGTATCAGTAGTTATGATGTGTATAATGCTGCCTTCTATCTTCCTTGCGGCATCCTCATATCTTTTTTTAAAAACTT
TGAGAACGCTCGGTGGGTCTAATGTGTTATATGTCACGAGTTCAGGTACTGCGTGGTCGCAAAAAGCGTCTTTAATAGACTAAAAGAGCAGCCTTACGTCGTGGAGCTTGATCATCATGG
TATTTATCATCTAATCTTTCTTTTGGCTGCTAACTGAAATGTTTTCTTTGTCCCGATTTCACTAGGAAGAATATTATGTTTTGACGGTCAAACACCTTAACCGACGTTATTTTCAGAGGA
TGGGGGCAGAATCCAGGAGGTGCTTTTTGACCGGGTTGGCCGTCGCACTGTTCCTCAAGTATTTGTGAACGGGCAGCATATTGGCGGCGCTGACG
GTTAGCCTTTCTTCTTGTTTTCTTA
GTTATGGTCTTGGTTTACTTTAATGTTTAATTATCAAGGTTTCTTGATTTTATATCTTGTAGATCTTGATGTAGCTGTCAAGAATGGTGCGTTGCAAGGTCTCCTGTGTACTTGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACGAAGACAATGGAGTTCCGATCAAATAATATCCGTAAATCCGGGATCTTACCGCTCGGAATCACGCTGTTGTTGATGATGATGATGTTTGCACCTACGAAAGTCGTAGGTTCG
ATGTCTCCGTCGGCTTTTTTTGAGAACCTTATCTACTCCAACAGGATCGTAATTTTCTCCAAAACCCAATGCCC
GTACTGCGTGGTCGCAAAAAGCGTCTTTAATAGACTAAAAGAGCAG
CCTTACGTCGTGGAGCTTGATCATCATG
AGGATGGGGGCAGAATCCAGGAGGTGCTTTTTGACCGGGTTGGCCGTCGCACTGTTCCTCAAGTATTTGTGAACGGGCAGCATATTGGCGGC
GCTGACG
ATCTTGATGTAGCTGTCAAGAATGGTGCGTTGCAAGGTCTCCTGTGTACTTGTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTAAACTAAG AAATTGTGGA CCATTCACCA TATCAATAAA TTCTTTAAAT CACCAATTTC CCATGCAAAC GCAACAGAAA TAATAAGGGT AAGATGAAGA CGAAGACAAT GGAGTTCCGA  TCAAATAATA TCCGTAAATC CGGGATCTTA CCGCTCGGAA TCACGCTGTT GTTGATGATG ATGATGTTTG CACCTACGAA AGTCGTAGGT TCGATGTCTC CGTCGGCTTT TTTTGAGAAC  CTTATCTACT CCAACAGGAT CGTAATTTTC TCCAAAACCC AATGCCCGTA CTGCGTGGTC GCAAAAAGCG TCTTTAATAG ACTAAAAGAG CAGCCTTACG TCGTGGAGCT TGATCATCAT  GAGGATGGGG GCAGAATCCA GGAGGTGCTT TTTGACCGGG TTGGCCGTCG CACTGTTCCT CAAGTATTTG TGAACGGGCA GCATATTGGC GGCGCTGACG ATCTTGATGT AGCTGTCAAG  AATGGTGCGT TGCAAGGTCT CCTGTGTACT TGTTGAATAT GAAAGAAAAC TGTTGGAATT ATCTTTTAAT GTAGCTTTAA CTTTTCTGCC TAATAACATG TAAAGTGTAA ATCGTTTACT  GGTTAATAAC ATAACTCGAA GGAGGCTAAT GTCTGTTTGC TTATACAAAC CGCGTTTGGT TCACTATTTG TTGTAAGAAT CGGAATCTGT GGTGGCATAA TCATTCCCAC TTGTAAGATG 
AAGCAATCGA CACTCTTGAA TCGA 

Retrieve as FASTA