Entry information : HaGrxC09(HanXRQChr08g0212511)
Entry ID 14413
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-02-03 (Catherine )
Peroxidase information: HaGrxC09(HanXRQChr08g0212511)
Name HaGrxC09(HanXRQChr08g0212511)
Class CGYC Grx    [Orthogroup: GrxC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC09
start..stop
S start..stop
HaGrxC04 124 7e-40 5..65 37..97
HaGrxC01 122 8e-39 5..65 37..97
HaGrxC20 121 1e-38 5..65 21..81
HaGrxC11 121 1e-38 5..65 33..93
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13916532..13916544 13 N° 2 13916344..13916442 99 N° 3 13916177..13916262 86  
complement(join(13916177..13916262,13916344..13916442,13916532..13916544))


exon

Literature and cross-references HaGrxC09(HanXRQChr08g0212511)
Protein sequence: HaGrxC09(HanXRQChr08g0212511)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   65
PWM (Da):   %s   6656.53  
PI (pH):   %s   9.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKVSDGGEIQSTLKEWTGQSIVPNVFIGGKHIGGSDAIMEKHRAGKLVLLLTEAGAIANASAQL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAAGTAAGTAGTGACTTTTGACTCTTTCGATGAATTGATTCATATCGGAGTTTGTATCAATAACATTTGAAGAAGTAATATGCATGGATTTGATAGGTGATGGAGGTGAAATCC
AATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATG
GTAAGTTGTTTGAGCAATTTTGTGTCTGTTTTTTAGTGT
TTGTTGATCGCAGATTGATTGATATTGTGGTCTTTTATGCAGCTATTATGGAGAAGCATCGAGCTGGGAAGCTAGTGTTGTTACTGACCGAAGCAGGTGCCATTGCGAATGCCTCTGCAC
AGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAAGTAAGTGATGGAGGTGAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATGCTATTATG
GAGAAGCATCGAGCTGGGAAGCTAGTGTTGTTACTGACCGAAGCAGGTGCCATTGCGAATGCCTCTGCACAGCTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAAG TAAGTGATGG AGGTGAAATC CAATCCACTC TAAAGGAGTG GACCGGTCAG AGTATTGTTC CTAATGTATT CATAGGTGGG AAGCACATTG GTGGCTCGGA TGCTATTATG 
GAGAAGCATC GAGCTGGGAA GCTAGTGTTG TTACTGACCG AAGCAGGTGC CATTGCGAAT GCCTCTGCAC AGCTCTGA 

Retrieve as FASTA