Entry information : HaGrxC10(HanXRQChr08g0219371)
Entry ID 14414
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-02-06 (Catherine )
Peroxidase information: HaGrxC10(HanXRQChr08g0219371)
Name HaGrxC10(HanXRQChr08g0219371)
Class CGYC Grx    [Orthogroup: GrxC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC10
start..stop
S start..stop
HaGrxC01 182 6e-62 1..100 1..97
HaGrxC17 180 3e-61 1..100 1..97
HaGrxC04 178 2e-60 1..100 1..97
HaGrxC19 177 4e-60 1..100 1..97
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40962594..40962613 20 N° 2 40962442..40962530 89 N° 3 40962227..40962348 122 N° 4 40962083..40962154 72
complement(join(40962083..40962154,40962227..40962348,40962442..40962530,4096259 4..40962613))


exon

Literature and cross-references HaGrxC10(HanXRQChr08g0219371)
Protein sequence: HaGrxC10(HanXRQChr08g0219371)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   100
PWM (Da):   %s   10794.41  
PI (pH):   %s   6.49
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQSYLSCKTWCGYCKSVKKLFSELNVSYKVIELDESDGGEIQSTLKEWTGQSIVPNVFIGGKHIGGSDGKLFEQFHRAGKLVPLLTEAGVIANASAQL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCTATCTTTCTTGGTTTGTCTTGATGAATGATGTTGTGTGATTAAGAACTAAGAAATTTTAACTTGATTTTGGCAGCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAA
CTGTTCTCTGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGAAGAAA
GTAAGTAGTGACTTTTGACTCTTTCGATGAATTGATTCATATCGGAGTTTGTATCAATAACATTTGAA
GAAGTAATATGCATGGATTTGATAGGTGATGGAGGTGAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCG
GATGGTAAGTTGTTTGAGCAATTTTGT
GTCTGTTTTTGAGTGTTTGTTGATCTCGGATTGATTGATATTGTGGTCTTTTATGCACCTATTATGGAGAAGCATCGAGCTGGGAAGCTGGTG
CCGTTGCTAACTGAAGCAGGTGTCATTGCGAATGCCTCTGCACAGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCTATCTTTCTTGCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAACTGTTCTCTGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGAAGAAAGTGATGGAGGT
GAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATGGTAAGTTGTTTGAGCAATTTTGT
CATCGAGCT
GGGAAGCTGGTGCCGTTGCTAACTGAAGCAGGTGTCATTGCGAATGCCTCTGCACAGCTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCT ATCTTTCTTG CAAGACTTGG TGTGGCTATT GCAAGAGCGT GAAGAAACTG TTCTCTGAGC TTAACGTGTC CTACAAGGTT ATCGAACTGG ATGAAGAAAG TGATGGAGGT  GAAATCCAAT CCACTCTAAA GGAGTGGACC GGTCAGAGTA TTGTTCCTAA TGTATTCATA GGTGGGAAGC ACATTGGTGG CTCGGATGGT AAGTTGTTTG AGCAATTTTG TCATCGAGCT 
GGGAAGCTGG TGCCGTTGCT AACTGAAGCA GGTGTCATTG CGAATGCCTC TGCACAGCTC TGA 

Retrieve as FASTA