Entry information : HaGrxC12 (HanXRQChr09g0254921)
Entry ID 14416
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC12 (HanXRQChr09g0254921)
Name (synonym) HaGrxC12 (HanXRQChr09g0254921)
Class CGYC Grx    [Orthogroup: GrxC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC12
start..stop
S start..stop
HaGrxC25 193 4e-66 1..107 1..107
ThasGrxC02 159 2e-52 1..107 1..107
HaGrxC23 151 2e-49 1..104 19..122
MpGrxC03 145 4e-47 1..102 1..102
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 128791917..128791972 56 N° 2 128792207..128792295 89 N° 3 128792409..128792507 99 N° 4 128792603..128792682 80
join(128791917..128791972,128792207..128792295,128792409..128792507,128792603..1 28792682)


exon

Literature and cross-references HaGrxC12 (HanXRQChr09g0254921)
DNA ref. HanXRQ genome:   HanXRQChr09 (128791917..128792682)
Protein sequence: HaGrxC12 (HanXRQChr09g0254921)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   107
PWM (Da):   %s   11246.75  
PI (pH):   %s   8.49
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAKAKELVSSNSVVVFSKSYCPYCVSVKKLFTELGSSFKTIELDLSDGSEMQSALHEWTGQRSVPNVFIGGKHIGGCDSTVAMHKAGKLVSLLTEAKAIATKAS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCCAAGGCCAAGGAACTCGTTTCATCCAACTCTGTCGTCGTCTTCAGGTATCATCCATACACCTCAAATTAGCTTGCATTTTGTATTATTTATATAAATCGCAACAGTTGA
GAACCTATTCGATCATTTTTGTTTAATTTGTGCGTAATGTATGATATATAACAACTTATGGATATAGAGGCCGGCCGATTTGTTTTTAAAATTAAAATGTATACGATGTTTATGTTATAG
ATTTAATTTTGAATGTATGTTTACGTTATATTTGATTTTGATTTTGACAGCAAATCTTATTGTCCGTACTGTGTGAGTGTTAAGAAGTTGTTTACTGAGCTTGGATCTTCGTTCAAAACC
ATCGAGCTTGACCTAGAAA
GTGAGTTCCTCTCTCGATCGATCGATATCCAATGTATTTATTTATACGTATGCTGAATTTGCAGTTATATGAACAATGTCTAAAAAGCCATGTGTATCTAT
CTATGTCTGAAGGTGATGGAAGTGAGATGCAATCAGCATTGCACGAGTGGACTGGCCAACGATCTGTACCAAATGTGTTTATTGGCGGCAAGCACATTGGCGGCTGTGACAGTAAGGCTT
TAATCTTTTTACTTTCCTTGTTTGACCCGTTATGTGTTTTCGCCAATGAACAACAGAATGTAATGTCCTGCAACAATTTTATGTAGGTACTGTTGCCATGCACAAAGCAGGAAAGCTTGT
TTCCCTGCTGACAGAAGCTAAAGCAATTGCTACCAAAGCTTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCCAAGGCCAAGGAACTCGTTTCATCCAACTCTGTCGTCGTCTTCAGCAAATCTTATTGTCCGTACTGTGTGAGTGTTAAGAAGTTGTTTACTGAGCTTGGATCTTCGTTC
AAAACCATCGAGCTTGACCTAGAAA
GTGATGGAAGTGAGATGCAATCAGCATTGCACGAGTGGACTGGCCAACGATCTGTACCAAATGTGTTTATTGGCGGCAAGCACATTGGCGGCTGT
GACA
GTACTGTTGCCATGCACAAAGCAGGAAAGCTTGTTTCCCTGCTGACAGAAGCTAAAGCAATTGCTACCAAAGCTTCCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTATACGTCA CCCGTATCCA AGTTAACCGT CCATGCGTCC TCCACTAACC CCCGTTTCTT AACCAGGTTC ATTACTCACC TAATTTCAAC TAATCATCTG ATTGTAATTA GGGTTTATAA  ATCATCACTT GAGTTGATAA TAATATTCAA ACAAACTAGC AATGGCTGCA GCCAAGGCCA AGGAACTCGT TTCATCCAAC TCTGTCGTCG TCTTCAGCAA ATCTTATTGT CCGTACTGTG  TGAGTGTTAA GAAGTTGTTT ACTGAGCTTG GATCTTCGTT CAAAACCATC GAGCTTGACC TAGAAAGTGA TGGAAGTGAG ATGCAATCAG CATTGCACGA GTGGACTGGC CAACGATCTG  TACCAAATGT GTTTATTGGC GGCAAGCACA TTGGCGGCTG TGACAGTACT GTTGCCATGC ACAAAGCAGG AAAGCTTGTT TCCCTGCTGA CAGAAGCTAA AGCAATTGCT ACCAAAGCTT  CCTAAACAAC TATTCTCATG ATATCTTTAT AAACAGAGTT GTGAACTTTC TTGTGTCCCA AATTTATGGG AATGTTGCAT TCGAATGTTT GGTATTTTTT TCAGGATACA TGTTTGTTAT  CTTTTGCTAT AAATGATGCT TGAAACCAGT TACCTTGTGA TGATTATTCA ATCAAACTGT GAAAGGATAC CAAAAAGGCC TGCCATCGTT TTCAACTCAA GAGGTTTTTT ATTTTGGTAC  GTCGCTATCC TTTTCAACTT AGAGAGGTTT TCTCACCGAC CACTCATCAT TTTCAATGAA CTATAAACTC CCGTATTCAT GCCTTCTAGT TATTCAGTGA AATTCCTATG TAGAGAATGC 
TTGATCTGCT CGTTT 

Retrieve as FASTA