Entry information : HaGrxC14 (HanXRQChr10g0289101)
Entry ID 14418
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC14 (HanXRQChr10g0289101)
Name (synonym) HaGrxC14 (HanXRQChr10g0289101)
Class CGYC Grx    [Orthogroup: GrxC003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC14
start..stop
S start..stop
HaGrxC05 185 2e-63 1..95 1..95
HaGrxC26 184 5e-63 1..95 1..95
HaGrxC22 184 5e-63 1..95 1..95
HaGrxC15 184 5e-63 1..95 1..95
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 66293813..66293955 143 N° 2 66294102..66294246 145  
join(66293813..66293955,66294102..66294246)


exon

Literature and cross-references HaGrxC14 (HanXRQChr10g0289101)
DNA ref. HanXRQ genome:   HanXRQChr10 (66293813..66294246)
Protein sequence: HaGrxC14 (HanXRQChr10g0289101)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   95 (71)
PWM (Da):   %s   10702.69 (8092.4) Transmb domain:   %s   i7-24o75-94i
PI (pH):   %s   8.73 (9.21) Peptide Signal:   %s   cut: 25 range:25-95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTSSSIFILFFTIATLFTSNTEASSVDFVKKIVSSHSIVIFSKSYCPYCKRAKGVFKELNAKPYVLELDERGEWFWILLFALLVIALVLNNFLI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACTAGTTCTTCCATTTTCATCCTCTTCTTCACCATTGCCACCCTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAATAGTCTCTTCTCACTCCATAGTC
ATCTTCTCCAAATCTTACTGTCC
GTACGTATTTTTCATTTCATATGATATCCCTATCAGTTCCGCATTCGTTTAATTATGTATTAAGAAATTATTTATATTTTTGATTTGTTTATTATTG
GTATAAATGTTTGAAAATGTTTTTTTTTTAATATTGTGTTGATCATCAGGTATTGTAAAAGGGCTAAAGGTGTATTCAAGGAGTTGAATGCGAAACCGTATGTACTCGAGCTCGATGAGA
GAGGTGAATGGTTTTGGATTCTTTTATTTGCACTTCTTGTTATTGCTCTTGTGCTAAATAATTTCTTAATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACTAGTTCTTCCATTTTCATCCTCTTCTTCACCATTGCCACCCTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAATAGTCTCTTCTCACTCCATAGTC
ATCTTCTCCAAATCTTACTGTCC
GTATTGTAAAAGGGCTAAAGGTGTATTCAAGGAGTTGAATGCGAAACCGTATGTACTCGAGCTCGATGAGAGAGGTGAATGGTTTTGGATTCTTTTA
TTTGCACTTCTTGTTATTGCTCTTGTGCTAAATAATTTCTTAATTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACTA GTTCTTCCAT TTTCATCCTC TTCTTCACCA TTGCCACCCT CTTCACATCC AATACCGAAG CATCATCCGT CGATTTCGTC AAGAAAATAG TCTCTTCTCA CTCCATAGTC  ATCTTCTCCA AATCTTACTG TCCGTATTGT AAAAGGGCTA AAGGTGTATT CAAGGAGTTG AATGCGAAAC CGTATGTACT CGAGCTCGAT GAGAGAGGTG AATGGTTTTG GATTCTTTTA 
TTTGCACTTC TTGTTATTGC TCTTGTGCTA AATAATTTCT TAATTTGA 

Retrieve as FASTA