Entry information : HaGrxC15(HanXRQChr11g0330531)
Entry ID 14419
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-02-03 (Catherine )
Peroxidase information: HaGrxC15(HanXRQChr11g0330531)
Name HaGrxC15(HanXRQChr11g0330531)
Class CGYC Grx    [Orthogroup: GrxC003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC15
start..stop
S start..stop
HaGrxC26 189 8e-65 1..95 1..95
HaGrxC22 189 8e-65 1..95 1..95
HaGrxC07-1E 189 8e-65 1..95 1..95
HaGrxC07-1D 189 8e-65 1..95 1..95
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 44014594..44014736 143 N° 2 44014305..44014449 145  
complement(join(44014305..44014449,44014594..44014736))


exon

Literature and cross-references HaGrxC15(HanXRQChr11g0330531)
Protein sequence: HaGrxC15(HanXRQChr11g0330531)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   95 (71)
PWM (Da):   %s   10762.75 (8152.5) Transmb domain:   %s   i7-24o75-94i
PI (pH):   %s   9.07 (9.52) Peptide Signal:   %s   cut: 25 range:25-95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTSSSIFILFFTIATLFTSNTEASSVDFVKKIVSSHSIVIFSKSYYPYCKRAKGVFKELNAKPYVLEIDERGEWFWILLFALLVIALVLNNFLI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCAGTTCTTCCATTTTCATCCTCTTCTTCACCATTGCCACCCTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAATAGTCTCTTCTCACTCCATAGTC
ATCTTCTCCAAATCTTACTATCC
GTACGTATTTTTCATTTTCATATGATATCCCTATCAGTTCCGCATTCGTTTAATTGTGTATTAAGAAATTATTTATATTTTTGATTTGTTTATTATT
GGTATAAATGTTTGAAAATGTTTTTTTAATATTGTGTTGATCATCAGGTATTGTAAAAGGGCTAAAGGTGTATTCAAGGAGTTGAATGCGAAACCGTATGTACTCGAGATCGATGAGAGA
GGTGAATGGTTTTGGATTCTTTTATTTGCACTTCTTGTTATTGCTCTTGTGCTAAATAATTTCTTAATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCAGTTCTTCCATTTTCATCCTCTTCTTCACCATTGCCACCCTCTTCACATCCAATACCGAAGCATCATCCGTCGATTTCGTCAAGAAAATAGTCTCTTCTCACTCCATAGTC
ATCTTCTCCAAATCTTACTATCC
GTATTGTAAAAGGGCTAAAGGTGTATTCAAGGAGTTGAATGCGAAACCGTATGTACTCGAGATCGATGAGAGAGGTGAATGGTTTTGGATTCTTTTA
TTTGCACTTCTTGTTATTGCTCTTGTGCTAAATAATTTCTTAATTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCA GTTCTTCCAT TTTCATCCTC TTCTTCACCA TTGCCACCCT CTTCACATCC AATACCGAAG CATCATCCGT CGATTTCGTC AAGAAAATAG TCTCTTCTCA CTCCATAGTC  ATCTTCTCCA AATCTTACTA TCCGTATTGT AAAAGGGCTA AAGGTGTATT CAAGGAGTTG AATGCGAAAC CGTATGTACT CGAGATCGAT GAGAGAGGTG AATGGTTTTG GATTCTTTTA 
TTTGCACTTC TTGTTATTGC TCTTGTGCTA AATAATTTCT TAATTTGA 

Retrieve as FASTA