Entry information : HaGrxC16HanXRQChr13g0389561
Entry ID 14420
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC16HanXRQChr13g0389561
Name HaGrxC16HanXRQChr13g0389561
Class CGYC Grx    [Orthogroup: GrxC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC16
start..stop
S start..stop
HaGrxC09 102 1e-31 1..53 1..53
HaGrxC01 100 3e-30 5..53 37..85
HaGrxC20 99 3e-30 5..53 21..69
HaGrxC17 100 3e-30 5..53 37..85
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17682324..17682336 13 N° 2 17682426..17682524 99 N° 3 17682606..17682655 50  
join(17682324..17682336,17682426..17682524,17682606..17682655)


exon

Literature and cross-references HaGrxC16HanXRQChr13g0389561
DNA ref. HanXRQ genome:   HanXRQChr13 (17682324..17682655)
Protein sequence: HaGrxC16HanXRQChr13g0389561
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   53
PWM (Da):   %s   5497.93  
PI (pH):   %s   9.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKVSDGGEIQSALKEWTGQSIVPNVFIGGKHIGGSDAIMEKHQAGKLVPLLT

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAAGTAAGTAGTGACTTCTGACTCTTTCGATGAATTGATTCATATCAGTGTTTGTATCCATAACATTTGAAGATGTAATATGCATGGATTTGATAGGTGATGGAGGTGAAATCC
AATCCGCTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATG
GTAAGTTGTTTGAGCAATTTCGTGTCTATTTTTGAGTGT
TTGTTAATGGCGGATTGATTGATATTGTGGTCTTTTATGCAGCTATTATGGAGAAGCATCAAGCTGGGAAGCTGGTGCCGTTGCTAACCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAAGTAAGTGATGGAGGTGAAATCCAATCCGCTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATGCTATTATG
GAGAAGCATCAAGCTGGGAAGCTGGTGCCGTTGCTAACCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAAG TAAGTGATGG AGGTGAAATC CAATCCGCTC TAAAGGAGTG GACCGGTCAG AGTATTGTTC CTAATGTATT CATAGGTGGG AAGCACATTG GTGGCTCGGA TGCTATTATG 
GAGAAGCATC AAGCTGGGAA GCTGGTGCCG TTGCTAACCT AA 

Retrieve as FASTA