Entry information : HaGrxC17HanXRQChr13g0391941
Entry ID 14421
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC17HanXRQChr13g0391941
Name HaGrxC17HanXRQChr13g0391941
Class CGYC Grx    [Orthogroup: GrxC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC17
start..stop
S start..stop
HaGrxC01 198 2e-68 1..97 1..97
HaGrxC04 194 5e-67 1..97 1..97
HaGrxC19 194 7e-67 1..97 1..97
HaGrxC11 182 4e-62 9..97 5..93
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35855451..35855470 20 N° 2 35855299..35855387 89 N° 3 35855107..35855205 99 N° 4 35854940..35855025 86
complement(join(35854940..35855025,35855107..35855205,35855299..35855387,3585545 1..35855470))


exon

Literature and cross-references HaGrxC17HanXRQChr13g0391941
DNA ref. HanXRQ genome:   HanXRQChr13 (35855470..35854940)
Protein sequence: HaGrxC17HanXRQChr13g0391941
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   97
PWM (Da):   %s   10416.24  
PI (pH):   %s   6.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQSYLSCKTWCGYCKSVKKLFSELNVSYKVIELDESDGGEIQSTLKEWTGQSIVPNVFIGGKHIGGSDAIMEKHRAGKLVPLLTEAGAITNASAQL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCTATCTTTCTTGGTTTGTCTTGATGAATGATGCTGTGTGATTAAGAACTAAGAAATTTTAACTTGATTTTGGCAGCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAA
CTGTTCTCCGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGAAGAAA
GTAAGTAGTGACTTTTGACTCTTTCGATGAATTGATTCATATCGGAGTTTGTATCAATAACATTTGAA
GAAGTAATATGCATGGATTTGATAGGTGATGGAGGTGAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCCAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCG
GATG
GTAAGTTGTTTGAGCAATTTTGTGTCTGTTTTTGAGTGTTTGTTGATCGCGGATTGATTGATATTGTGCTCTTTTATGCAGCTATTATGGAGAAGCATCGAGCTGGGAAGCTGGTG
CCGTTGCTAACCGAAGCAGGTGCCATCACGAATGCCTCTGCACAACTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCTATCTTTCTTGCAAGACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAACTGTTCTCCGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGAAGAAAGTGATGGAGGT
GAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCCAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATG
CTATTATGGAGAAGCATCGAGCTGGGAAGCTG
GTGCCGTTGCTAACCGAAGCAGGTGCCATCACGAATGCCTCTGCACAACTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAAGCT ATCTTTCTTG CAAGACTTGG TGTGGCTATT GCAAGAGCGT GAAGAAACTG TTCTCCGAGC TTAACGTGTC CTACAAGGTT ATCGAACTGG ATGAAGAAAG TGATGGAGGT  GAAATCCAAT CCACTCTAAA GGAGTGGACC GGTCAGAGTA TTGTTCCCAA TGTATTCATA GGTGGGAAGC ACATTGGTGG CTCGGATGCT ATTATGGAGA AGCATCGAGC TGGGAAGCTG 
GTGCCGTTGC TAACCGAAGC AGGTGCCATC ACGAATGCCT CTGCACAACT CTGA 

Retrieve as FASTA