Entry information : HaGrxC21HanXRQChr14g0441541
Entry ID 14425
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC21HanXRQChr14g0441541
Name HaGrxC21HanXRQChr14g0441541
Class CGYC Grx    [Orthogroup: GrxC006]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC21
start..stop
S start..stop
HaGrxC08 175 2e-57 37..167 5..137
AtGrxC03 150 1e-47 50..168 10..128
ThasGrxC03-2 136 3e-42 45..168 6..131
ThasGrxC04 135 5e-42 74..168 30..124
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106299766..106300049 284 N° 2 106298740..106298813 74 N° 3 106298525..106298623 99 N° 4 106298371..106298426 56
complement(join(106298371..106298426,106298525..106298623,106298740..106298813,1 06299766..106300049))


exon

Literature and cross-references HaGrxC21HanXRQChr14g0441541
DNA ref. HanXRQ genome:   HanXRQChr14 (106300049..106298371)
Protein sequence: HaGrxC21HanXRQChr14g0441541
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   19276.34  
PI (pH):   %s   10.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRFNSSVPLPNFTISNFRRKLERRDRNQNNFETKMTTVHRPNNRRKLGVLAFGIMILLAIHAPKKVAASKSPSAFVETVIYSNKIAIFSKSYCPYCRRAKRVFSELKEQPYVVELDQDDGYKIQNVLLDLVGRRTVPQIFVNGKHIGGADDLEVAVRNGVLQDLLGKK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCGTTTCAACAGTTCTGTTCCGTTGCCTAATTTCACAATTTCCAATTTTAGACGCAAGCTCGAACGCCGAGACCGAAACCAAAACAACTTCGAGACGAAGATGACGACGGTGCAC
CGGCCAAATAACCGTCGTAAGCTCGGAGTTTTAGCATTCGGAATCATGATTCTGTTGGCGATCCATGCACCGAAGAAAGTCGCTGCTTCCAAGTCTCCGTCGGCTTTCGTTGAGACCGTC
ATTTACTCCAATAAGATCGCAATTTTCTCTAAATCCTACTGTCC
GTTAGTATTCTTTCTATTAACATGTATATAGCTTAAAACGATTCATATGCTTGATTTATGAAGATTTGCGATGATT
TTGAGTTGAATATGTAGTTAGGATTGCTAGAAGTCATTTATTTTGACTCCTTATATCTGCGAAGATTGATTAATAATTAATAGAATTATGTATAGAGTGTAAAACTGATACACAGAGATA
AGTTTTGATTAGGTATCTGAAAATCTGAAATACATATATCTGAATATCTGTTTTATGGCGGTATCCTTCGGTAATTCTCGAATGAAGTTGTTCGCTTAACTGAATTGATTAGAAGTTTCT
AGTTAATCTCATAGGCTTACTGATCTTGTATTTATAGAAACTGATAACTTATTACTACTGTCCTTTTGATAGGCATTCTGATTACATATCCATGTTTAGATTTGGAGGATTGATCATTGA
GGTATTCGTAGGGTAGCACAACATGGTTAATGTATTGGTAGTTATGATGCCATATGAGAGCTAATTAGGTATGTAACTAACTATTGTAGTTAGTATTGAGATGAATCGAATGATACAATG
CATAGCCTTCTAATGTATAGGAAGCTAGATCGCAAACTAACTGAATGTACAACTACTAGATGGATACATAATAGAATTTTACAATATGCTACTGCACTAACTGATAACTAACAGCTCATA
TATATAGGTTTCTAAGACGTCTGCTACATACATACAGTGTTGCCTTCTATTTACTCTGCTTAAACCCTGATTATTGTTGAAGCATTGTTATATACCATTAATATTATGAGATATTATATT
GCTAAATATTCGAAGCAAGTCGACAATTTATTTTAAAAAATTTAAGGATAATATGTGAAGGAAGCACATGGTTCTACTCCAATAGATTGAATAGACAAGTCATTTATTATTGGAAACAAT
GTTGAGAACTGTCGGTGTTATATGCCATGAATGCAGGTACTGTCGACGCGCAAAACGTGTCTTTAGTGAGCTAAAAGAGCAACCTTATGTTGTTGAGCTTGATCAAAGAGGTATTTGTCA
TCTAATCTTACTTTGACAGCTAACTGTTAATATTGTCTTGAATCAGTTTCACTTGGAATAATATAATGTCTAATGGTCAAAACATATCAAACAATGTTATTTTCAGATGATGGGTACAAA
ATCCAGAATGTGCTTTTAGACCTGGTTGGCCGTCGCACGGTTCCTCAGATATTTGTGAATGGGAAGCATATTGGTGGTGCTGATG
GTTAGTTTGACTTCTCTTTTGTTTAGTTATGCTCT
TTGGTTACTTTAAAATCAATTAGTAAGGTTTCTTATTTTAATATAAATACTTTATTCGTGTAGATCTTGAAGTAGCTGTTCGGAATGGTGTGTTGCAAGATCTCCTGGGTAAAAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCGTTTCAACAGTTCTGTTCCGTTGCCTAATTTCACAATTTCCAATTTTAGACGCAAGCTCGAACGCCGAGACCGAAACCAAAACAACTTCGAGACGAAGATGACGACGGTGCAC
CGGCCAAATAACCGTCGTAAGCTCGGAGTTTTAGCATTCGGAATCATGATTCTGTTGGCGATCCATGCACCGAAGAAAGTCGCTGCTTCCAAGTCTCCGTCGGCTTTCGTTGAGACCGTC
ATTTACTCCAATAAGATCGCAATTTTCTCTAAATCCTACTGTCC
GTACTGTCGACGCGCAAAACGTGTCTTTAGTGAGCTAAAAGAGCAACCTTATGTTGTTGAGCTTGATCAAAGAGAT
GATGGGTACAAAATCCAGAATGTGCTTTTAGACCTGGTTGGCCGTCGCACGGTTCCTCAGATATTTGTGAATGGGAAGCATATTGGTGGTGCTGATG
ATCTTGAAGTAGCTGTTCGGAAT
GGTGTGTTGCAAGATCTCCTGGGTAAAAAGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCAATGCCTC GTTTCAACAG TTCTGTTCCG TTGCCTAATT TCACAATTTC CAATTTTAGA CGCAAGCTCG AACGCCGAGA CCGAAACCAA AACAACTTCG AGACGAAGAT GACGACGGTG  CACCGGCCAA ATAACCGTCG TAAGCTCGGA GTTTTAGCAT TCGGAATCAT GATTCTGTTG GCGATCCATG CACCGAAGAA AGTCGCTGCT TCCAAGTCTC CGTCGGCTTT CGTTGAGACC  GTCATTTACT CCAATAAGAT CGCAATTTTC TCTAAATCCT ACTGTCCGTA CTGTCGACGC GCAAAACGTG TCTTTAGTGA GCTAAAAGAG CAACCTTATG TTGTTGAGCT TGATCAAAGA  GATGATGGGT ACAAAATCCA GAATGTGCTT TTAGACCTGG TTGGCCGTCG CACGGTTCCT CAGATATTTG TGAATGGGAA GCATATTGGT GGTGCTGATG ATCTTGAAGT AGCTGTTCGG  AATGGTGTGT TGCAAGATCT CCTGGGTAAA AAGTGAATAT GAAGAGAAAC TGTCAGTATT TTCTTTTGAT GTGGTTTTAA CTTTTCTTCC ACCTGAGCAT GTAAAATGTA AATCAATTAC  TGGTGATAGT ATAATTTGGA GAAAACTGAA GTTTGTTTGC GTTTCTAGTT GTCGACCTTA TTCTGTACAA ACCAACTTCT TTACTCTTAT CTTCTCTACA ATTAGTCTAC TTTCCAACAC 
TTTATCATGT GTTTTACCAC 

Retrieve as FASTA