Entry information : HaGrxC24HanXRQChr15g0468121
Entry ID 14428
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC24HanXRQChr15g0468121
Name HaGrxC24HanXRQChr15g0468121
Class CGYC Grx    [Orthogroup: GrxC004]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC24
start..stop
S start..stop
HaGrxC13 223 4e-76 18..164 25..171
ThasGrxC05-2 184 2e-60 16..162 39..177
ThasGrxC05-1 180 4e-59 63..162 68..167
AtGrxC05 170 4e-55 60..162 65..167
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14165369..14165625 257 N° 2 14165187..14165260 74 N° 3 14163861..14163935 75 N° 4 14163434..14163460 27
N° 5 14162975..14163039 65  
complement(join(14162975..14163039,14163434..14163460,14163861..14163935,1416518 7..14165260,14165369..14165625))


exon

Literature and cross-references HaGrxC24HanXRQChr15g0468121
DNA ref. HanXRQ genome:   HanXRQChr15 (14165625..14162975)
Protein sequence: HaGrxC24HanXRQChr15g0468121
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   165
PWM (Da):   %s   17906.29  
PI (pH):   %s   9.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATSVFSRTFSSVSLSHIPNSPSLPFISRNFSHRKTSSRTCLTIRKHGALKVHSMTASFDSRLEDTVKKTVADNPVVVYSKTWCPYSSEVKSLFNQIGVQPLVVELDEGAQGPQVQKVLEQLTGQHTVPNVFIGGKHIGGCTDTVNLHRKGELEALLAEAKNT

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAACTTCTGTATTCTCTAGAACCTTCTCATCTGTTTCTCTTTCTCACATACCTAACTCCCCTTCTCTTCCGTTCATCTCTCGCAACTTTTCTCATCGCAAAACATCATCACGA
ACATGTTTAACGATCAGGAAACATGGTGCTCTCAAGGTTCACTCCATGACTGCTTCCTTTGACTCTCGGTTAGAAGATACTGTCAAGAAAACAGTCGCTGATAATCCCGTTGTTGTCTAC
TCCAAAACCTGGTGTCC
GTAAGTTAATTAGCCTAGGGTTTTATGTTTTTTAATTTATGGTTTGAACTTTGAAGCTTATTATGTTGTTGAAGTGATTTCTTATGTTTTGATTATCGTGTTG
TTAAGGTATTCTTCTGAAGTGAAGTCGTTGTTTAATCAGATTGGTGTGCAGCCGCTTGTTGTTGAATTGGATGAAATTGGTGAGGATTTTTTTTATTTTTATTTAATTTGGGGATTTTTT
GGGGGAAGTTGGTAATTCTTTTAGATTGTTAGGGTTACATAAGAGGTGTTTATATAGACATATTTTTGGTACCGAATTTTGGCATTTTTGGTACCCGTACGATATACGGTTCATTACCGG
TATTTGAAGGTTCGGTACCGGTATTTGAAGGTTCAAATACCGGTAATGAACTGTATCGTACTGTGTATTTTCAGGTACCGGTACCCATTTTGGGGATTTTCGGTACCGGGCTCATCCCTA
TTTGACGGGATATACCCTGGAATGAGCTATAGCTTGATGAAAACAAGGTCTTGTTGATTAACTGACAAATGAACGGATCCTCCGATGCGTCGTGTTTTGGACAACGGGTTGGTGGATCAA
CTCTAGTTACCCAAAAGATCTCGGTCAGCTATATCCAAGTCGAGCCCGGGTGATACGAACCTGGTGCGGGTCAGAACCAATTAATGTGGGTGGCGGGAAAATTGAATGGTGGGGAGCAGT
TAGAAGACCAAGTTTTTAGGAGCAGTTAACACCAGATATTATGTTAAATAGCAGGCTCTGTTTTCCTTTTAGATTGTCTATGTTTATGTTATTAAATTAGGGTTCTTACCTTATAATTGG
AGATCAAGCCTATCTCGAATGTGGCTAATTGTAATCGTTCTCTTAGTAATCAAGGCTTTCAGTTTTTTGGGTTCTATCACCGGGCATCAATAGCCTGACATAACGGTGATCATAAGATCG
AAGCGCAAAGGAACAAAGGAGTGAGTCGGGTTGGGACTGATGGTGCAGCCGGGCCATAACATACGTTCCGACCACAGACGTAAGATGCGGATGAAGCAGATGTTAAGGCAAGCTGCCAAG
CGTTTAATGCTACGGATTTTGGCAGGGACCAAATCTTTTAGACGTACCAATACCCAGTGGATTAGCTTTACGTCTTTAAACCACTGTGCCACTCCCCTAATTGTTCAGTTATTTGTAATT
GTAGTCAAGGTTCTTTTGACCAAACCCCACATGTCATATGCTAGTTATCATGATGTTTAGGATCAAATACAAAGGTTCCTAAGAATAAGAAGTCGTACAAAGGGCATCAAATGGACTCCG
ATTGACCTCATTCAAGCAGTGGAACTGTCTCATATATGTAGTTAAAGCTGCAATATCTGTGAATAAGTTGTTAGGAACTTAGGGTTTGTAAACACTGCCGAAGGTCACTTTTTAATTTTT
TTTATTTCAGGTGCGCAAGGACCACAGGTACAGAAAGTTCTTGAACAGCTAACTGGACAACATACCGTTCCAAATGTTTTTATTGGTATGTAGACTATGCATTAAGAATGTCATATATTT
TTTCACTTGATACTTAGCATGGTATAATTTAATTGAACTGATCTCGATCATAAGCAGTTAGCCGCGTACTGCATAGATTTCTAATCATAAGCACCCAACGTGCGTGATATAGAATGTACT
TTCGACTCCTTTAGTATAAGTGGGCCTAGTTGAGTTATGTTTTATCTCAAACGTGTCGAATGGGTTGTAAGTCACAGTGTCTCACAAAGTGTAAAAGGTAATGGAAGGGTCCGCACTCAC
GGTGTGACTATTGCTGAAAGTGCTGACCTTCCATCTTCTTTTACAATATCAACAACACTAAAGAAGAAACTATGAAATAAAAAATAAACATAATTTCTGAGCTCATTTATCGTTTTTTCT
AACAGGGGGCAAGCACATAGGCGGTTGTACAGGTACCTTCTTTACCAGTTCCTTTAGCTCATTCTTCTCGTATGTGGATTCTGATTTGGGTTACATTTAATAATATATTAGTACTTTCTT
ACACCGGTTTTGTATAAACAAGTCGGGTTGGTGGAACACGTAATGGGCCAAAACTGCTATGGTTTAGTATGTATTCTGTTGACCTGATACACTTGTTGACCTTTTCCGATTTTTATACAT
AAATAATGTTACGACTACAAAATTATATTATTATTGAGATAGTCTAATCGTAAGATAAAGCGATTTAGGAGGTTGTATACTTGTATCATTAATTAAAGACACTTGGGTTAACTTACGTCC
CGTTTCCCTTTAAAGTAAATTGTTTTCGGATGTTTTTGTATAATGTTGATTTGTGATTTGGCGCAGATACTGTCAATTTACATAGGAAGGGGGAACTTGAAGCTTTGCTGGCTGAGGCGA
AAAACACCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAACTTCTGTATTCTCTAGAACCTTCTCATCTGTTTCTCTTTCTCACATACCTAACTCCCCTTCTCTTCCGTTCATCTCTCGCAACTTTTCTCATCGCAAAACATCATCACGA
ACATGTTTAACGATCAGGAAACATGGTGCTCTCAAGGTTCACTCCATGACTGCTTCCTTTGACTCTCGGTTAGAAGATACTGTCAAGAAAACAGTCGCTGATAATCCCGTTGTTGTCTAC
TCCAAAACCTGGTGTCC
GTATTCTTCTGAAGTGAAGTCGTTGTTTAATCAGATTGGTGTGCAGCCGCTTGTTGTTGAATTGGATGAAATTGGTGCGCAAGGACCACAGGTACAGAAAGTT
CTTGAACAGCTAACTGGACAACATACCGTTCCAAATGTTTTTATTG
GGGGCAAGCACATAGGCGGTTGTACAGATACTGTCAATTTACATAGGAAGGGGGAACTTGAAGCTTTGCTGGCT
GAGGCGAAAAACACCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGTATAC ATAAACACGA AACACAGAGG ACCAAAGGAG CAAGCAAGCA TCAATGGCAG CAACTTCTGT ATTCTCTAGA ACCTTCTCAT CTGTTTCTCT TTCTCACATA CCTAACTCCC  CTTCTCTTCC GTTCATCTCT CGCAACTTTT CTCATCGCAA AACATCATCA CGAACATGTT TAACGATCAG GAAACATGGT GCTCTCAAGG TTCACTCCAT GACTGCTTCC TTTGACTCTC  GGTTAGAAGA TACTGTCAAG AAAACAGTCG CTGATAATCC CGTTGTTGTC TACTCCAAAA CCTGGTGTCC GTATTCTTCT GAAGTGAAGT CGTTGTTTAA TCAGATTGGT GTGCAGCCGC  TTGTTGTTGA ATTGGATGAA ATTGGTGCGC AAGGACCACA GGTACAGAAA GTTCTTGAAC AGCTAACTGG ACAACATACC GTTCCAAATG TTTTTATTGG GGGCAAGCAC ATAGGCGGTT  GTACAGATAC TGTCAATTTA CATAGGAAGG GGGAACTTGA AGCTTTGCTG GCTGAGGCGA AAAACACCTA ACTCGATATT GCTCAACTGT TTTGATGCAC AACCTTATTT TCTGAATTGT  TGTGATGCAC AAAAAATGAT ATATATTTTT TTGCTGTTTT GTTGGCCAAA CTTGACTAAT TTTGATGTAA TCTTGTTGAT CTTGTGATAT AACTGGATTA AAAGGATGAG TAGCATGCTA  AATTGCTAAT GACATCTCAT GTGCATGAGT AGAGATTAGA AAAACCGAAT AACATAACTA GGGGTGTAAA CGAGCTAGAC TGAGCTCTCC ACTAGAAAAA CTGAATAAAA TAACTCGAGG 
GTGTAAATGA 

Retrieve as FASTA