Entry information : HaGrxS03 (HanXRQChr11g0331711)
Entry ID 14434
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxS03 (HanXRQChr11g0331711)
Name (synonym) HaGrxS03 (HanXRQChr11g0331711)
Class CGFS Grx    [Orthogroup: GrxS004]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxS03
start..stop
S start..stop
ThasGrxS13 375 4e-132 1..292 1..292
AtGrxS13 360 2e-126 1..290 1..292
PpaGrxS04 288 2e-98 60..291 6..242
MpalGrxS01 289 5e-98 53..292 66..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51404650..51405024 375 N° 2 51405607..51406110 504  
join(51404650..51405024,51405607..51406110)


exon

Literature and cross-references HaGrxS03 (HanXRQChr11g0331711)
DNA ref. HanXRQ genome:   HanXRQChr11 (51404650..51406110)
Protein sequence: HaGrxS03 (HanXRQChr11g0331711)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   292
PWM (Da):   %s   31869.33  
PI (pH):   %s   8.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAMNLSSPSFTTTATSSFLSANRTKTLLSHSSYTKNPSIFSPIPLKITHTTKNPRPYLNLVVSAIGKLSESETVPVSSVFPSASGVYAVYDKNGDLQFVGLSRNIQASVLFHQKSVPELCASIKVGMVDNPDRTSLTEAWKSWMEEHIEVTGKVPPGNEKGNTTWVRQAPKKKSDLRITPGPNTKLTVPLEELIDRMVKENKVVAFIKGSRSAPQCGFSQRVVGILDSEGVDYESVDVLDEEHNSGLRETLKRYSNWPTFPQVFVNGELVGGCDILSSMHEKGELAGLFKQ*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGATGAACCTCTCATCACCATCTTTCACAACCACTGCCACCTCCTCCTTCCTGTCCGCCAATCGCACTAAAACCCTACTTTCTCACTCCTCCTACACCAAAAATCCCTCCATC
TTCTCCCCAATTCCACTTAAAATTACCCACACAACCAAAAACCCTCGCCCTTATCTCAATCTCGTCGTTTCTGCCATCGGAAAGCTCTCGGAATCGGAAACTGTCCCCGTTTCATCCGTT
TTCCCTTCGGCTTCCGGTGTTTACGCTGTCTATGACAAGAATGGTGATTTGCAGTTTGTGGGGTTGTCACGCAACATTCAGGCGAGTGTTCTGTTTCACCAGAAATCAGTGCCGGAGCTT
TGTGCTTCCATCAAG
GTACTTGCTTTAATTATGTTTATATAATTATTTTACATTTCCCATATGTTTCTAGGACCAATCTAGACATAAATAACATCTATTAAATAAAGTATATACACAACA
TCTTGATGCTAAACAAAAGTCTCTATCTTAATTGTTTGATCAATGAAACGATGTTGGGTATGTTTGGCAAAAGTAGCTGGTTGTTGGTGGCTGGAAACTGGTAGACTGTGGCGGTAGTAG
CTTTTTGGATGTAATTGGTGTTTGACAGAGTAGCTGGAGCTTTTAATAAAATGTATAAAATGACCAAAATGGACATAACTAAAAATTTAAAAAGTTTGTGCATTAAAATGTTCATTATCT
TTAGAGGTTAAAATAGTCATTTTTTCTATAAAAGCTTGTAGCTCATTCTAAACGCCTCTAGTAAGAGCGTTCAACCAAAACTTTAAGCTCCCGACCTAAAAGCTTTAAGTTCCTTCAACC
AAATAAGGCTTTTTATTGAGTATGAGCTTTTTCTTAAAAGCTTAAAGCTAGAAGTTCCTAAAAGCTCAATGCCAAACATACCTGTTGTGGTGATTATTTTCTGTATGATTTTGATAGGTT
GGAATGGTGGATAATCCGGATAGAACATCATTAACCGAAGCATGGAAATCATGGATGGAAGAACATATAGAAGTGACCGGAAAAGTGCCACCTGGCAACGAGAAAGGAAACACGACGTGG
GTCCGCCAAGCACCCAAGAAAAAGAGTGATCTAAGGATCACACCAGGTCCAAACACGAAACTAACCGTTCCATTAGAGGAACTAATAGACCGTATGGTCAAAGAAAACAAGGTGGTGGCT
TTCATCAAGGGGTCAAGAAGTGCTCCACAATGCGGTTTCTCACAACGGGTGGTTGGGATTTTGGACTCGGAAGGTGTGGATTATGAGAGCGTGGACGTGTTGGATGAAGAACATAATAGT
GGATTGAGGGAGACCCTGAAGAGGTATAGCAATTGGCCTACTTTCCCACAAGTGTTTGTGAATGGTGAATTGGTTGGAGGGTGTGATATATTGTCGTCTATGCACGAGAAGGGCGAGCTT
GCTGGTCTTTTTAAGCAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGATGAACCTCTCATCACCATCTTTCACAACCACTGCCACCTCCTCCTTCCTGTCCGCCAATCGCACTAAAACCCTACTTTCTCACTCCTCCTACACCAAAAATCCCTCCATC
TTCTCCCCAATTCCACTTAAAATTACCCACACAACCAAAAACCCTCGCCCTTATCTCAATCTCGTCGTTTCTGCCATCGGAAAGCTCTCGGAATCGGAAACTGTCCCCGTTTCATCCGTT
TTCCCTTCGGCTTCCGGTGTTTACGCTGTCTATGACAAGAATGGTGATTTGCAGTTTGTGGGGTTGTCACGCAACATTCAGGCGAGTGTTCTGTTTCACCAGAAATCAGTGCCGGAGCTT
TGTGCTTCCATCAAG
GTTGGAATGGTGGATAATCCGGATAGAACATCATTAACCGAAGCATGGAAATCATGGATGGAAGAACATATAGAAGTGACCGGAAAAGTGCCACCTGGCAACGAG
AAAGGAAACACGACGTGGGTCCGCCAAGCACCCAAGAAAAAGAGTGATCTAAGGATCACACCAGGTCCAAACACGAAACTAACCGTTCCATTAGAGGAACTAATAGACCGTATGGTCAAA
GAAAACAAGGTGGTGGCTTTCATCAAGGGGTCAAGAAGTGCTCCACAATGCGGTTTCTCACAACGGGTGGTTGGGATTTTGGACTCGGAAGGTGTGGATTATGAGAGCGTGGACGTGTTG
GATGAAGAACATAATAGTGGATTGAGGGAGACCCTGAAGAGGTATAGCAATTGGCCTACTTTCCCACAAGTGTTTGTGAATGGTGAATTGGTTGGAGGGTGTGATATATTGTCGTCTATG
CACGAGAAGGGCGAGCTTGCTGGTCTTTTTAAGCAGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAAACAAAA CAAAAGATAA TTTCATCTCT TGCCCAAACC TATGTGGCGC CAACTGGGTG AAATAATAAT CTCAGATTAG TATTATCATC ATCATCATCA TCAGCTAAAC GGAAGCACTC  TCAATGGCGG CGATGAACCT CTCATCACCA TCTTTCACAA CCACTGCCAC CTCCTCCTTC CTGTCCGCCA ATCGCACTAA AACCCTACTT TCTCACTCCT CCTACACCAA AAATCCCTCC  ATCTTCTCCC CAATTCCACT TAAAATTACC CACACAACCA AAAACCCTCG CCCTTATCTC AATCTCGTCG TTTCTGCCAT CGGAAAGCTC TCGGAATCGG AAACTGTCCC CGTTTCATCC  GTTTTCCCTT CGGCTTCCGG TGTTTACGCT GTCTATGACA AGAATGGTGA TTTGCAGTTT GTGGGGTTGT CACGCAACAT TCAGGCGAGT GTTCTGTTTC ACCAGAAATC AGTGCCGGAG  CTTTGTGCTT CCATCAAGGT TGGAATGGTG GATAATCCGG ATAGAACATC ATTAACCGAA GCATGGAAAT CATGGATGGA AGAACATATA GAAGTGACCG GAAAAGTGCC ACCTGGCAAC  GAGAAAGGAA ACACGACGTG GGTCCGCCAA GCACCCAAGA AAAAGAGTGA TCTAAGGATC ACACCAGGTC CAAACACGAA ACTAACCGTT CCATTAGAGG AACTAATAGA CCGTATGGTC  AAAGAAAACA AGGTGGTGGC TTTCATCAAG GGGTCAAGAA GTGCTCCACA ATGCGGTTTC TCACAACGGG TGGTTGGGAT TTTGGACTCG GAAGGTGTGG ATTATGAGAG CGTGGACGTG  TTGGATGAAG AACATAATAG TGGATTGAGG GAGACCCTGA AGAGGTATAG CAATTGGCCT ACTTTCCCAC AAGTGTTTGT GAATGGTGAA TTGGTTGGAG GGTGTGATAT ATTGTCGTCT  ATGCACGAGA AGGGCGAGCT TGCTGGTCTT TTTAAGCAGT GAAAAGATCA ATAACCACGT CATGTGTTTT CTCTTGTAGT ACTTTGTATT TGTGGATTAT TACAGAAATC CCTTATTTAC  ATCATTTAGT TTTATATCAT TTGAACCATA AAGTCTAACG AGTTACAAAT TTCAGTTAGA GCGTTAACTC TTAAAGAGTA ATAATAGTAG GCAATATTAT AGTAGTTAAA GGCCCAAGGC 
GCAAAGGCTT CGCCGCACAC CTGAGACAAG CAAGGCGT 

Retrieve as FASTA