Entry information : HaGrxS04 (HanXRQChr14g0451571)
Entry ID 14435
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxS04 (HanXRQChr14g0451571)
Name (synonym) HaGrxS04 (HanXRQChr14g0451571)
Class CGFS Grx    [Orthogroup: GrxS003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxS04
start..stop
S start..stop
ThasGrxS15-2 190 1e-62 58..174 67..184
ThasGrxS15-1 187 3e-61 61..174 83..197
AtGrxS15 184 2e-60 66..174 65..173
MpalGrxS02 178 9e-58 63..174 84..195
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 144435622..144435820 199 N° 2 144433709..144433978 270 N° 3 144433571..144433626 56  
complement(join(144433571..144433626,144433709..144433978,144435622..144435820))


exon

Literature and cross-references HaGrxS04 (HanXRQChr14g0451571)
DNA ref. HanXRQ genome:   HanXRQChr14 (144435820..144433571)
Protein sequence: HaGrxS04 (HanXRQChr14g0451571)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   174
PWM (Da):   %s   19198.88  
PI (pH):   %s   9.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSITFHSQLASSSRIPSFEFVSRASTINRSALRYQPRTATFGTLKFSSHAIRTGVPARRIGCFAALSPELKTTLDKVVTSHKVIVFMKGTKDFPQCGFSNTVVSILKAVNVPFETVNILENEMLRQGLKEYSQWPTFPQLYIDGEFFGGCDITVDAYKSGELQEILEKASLS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCTCTATCACCTTTCACTCGCAATTGGCCTCCTCATCACGAATCCCCTCTTTCGAATTTGTTTCCCGTGCATCCACAATCAATCGCTCTGCACTGCGCTACCAACCTCGTACC
GCCACCTTTGGCACCTTAAAATTCAGCTCTCACGCTATTAGGACTGGAGTTCCTGCAAGAAGAATTGGATGCTTTGCTG
GTATATGTTTTTACTACACTAGTTTTAAGAATCCCTAACTA
ATTAATAATATCTTTCACCCTTTCACTTAGGGTTAGCTTTTGTGTGTGTAAAACGTTGTCAAGAATTGTTTTGCTTGTAGGTTTAAGGAGTATTATGTTTATCTGAGTTTTAGATTTTAT
AAAAATTGAATCTTGAACTCATAGAGTCTAGAATTAGTGACTACTGTCATATAGGGCTGTTCAAATTGCTCGAGACTCGTTCGATGCTCTATCGAAAAATGTTCGGAATTTGCTTGTTCA
ATTCTGCTCGATTGAAAAACGCAGTCGGTTCGGATCGGTTCGGTTGAAACGAACCGAGGATGAGCAAAGGTCCGCTCAGTTCGGTTCGACTCGGTTGGCTTGAATAATTTTTTAATATAT
ATATGTATATATCATAATAAAATAACTAGAGATGCATATTAACAATGTTTCGTCCAAGATCCATCTAGAGCTCATTTAATTATAGAATTGAAGGCTGATACCAATAGTCCATTGCCTAAT
AATCCAGAGTAATTGAGTCAAAATATCAAAATACCGAATGTGAAAGGTCGATCGATACTTAAGTGTCAACCCGCCATTCAGTTCTAAAGTACATAATCCTAATTAAACCCTGCATCAACC
ATCATTGTTCAAATTCTCCGTCTTCAAGACGCCAACTCCCTAAGGTTTTGCTTCAATCGGTTCATTGATTTCAAACTTCTCATAGATCCAAGGTTTGCTCCAAGGTTTGCTTCAATCGTT
CGACGATTCATCTTTCCGCTCAGATGATCTCGGTACAACTAGTTGAGTGTTTTTCTATTCCTTGTTATTTCGTAAATTTATACTTGTGTTCTAATTAGACGAAACCTTAGGGACGAAAAC
TGTACTTTACTCTAAAAACTAACAACCCCATCGTCACTTTTCTATTTGTTATGTGACGCTCGATACTCTCTCGACGTTCGTTCGAAAAATACTCGGATTGAAAGGCGCTCGTTCGTCTTT
GGCTAAGTTAAAAAAACGCTTGGTTCGGTTCGGTTCTCTTTGTAAACTAACCGAGCACGAGCAACGGTCGGATCGGTTCGGTTCGGCTCGTGAACAACCCTACTGTCATAGTTGATTCAT
AGGGAAAAGGTATATTTGTAATCAAGTAATCAACCATAGCGGTCGCTATAGCGAATAGTGAAGCGTATAGGTGTAAGGTAGCCAAATAGCGGGATTTTAGTTTATTTTATTTTTATTTTT
AAAATATAAATAGCGATTAAATATAGCTATAAAATAACTGGAGTTTAGGTTTTTGTTAAATATACATGTAAAATAGCCTATATACCAGGGTATTTTGATATAATATACATATAAATTTTT
TTGTAGTGTATCGCTATTCGCTATGTGGCATATAGGATTATAGGTACCTTATTGTCATTTGTCGCTATTCGCCATTTACAACTATGCTATATACAGAGTGTGAGATGTAGCATATAGTTT
AGCACACATTAGCATTACCAATTTTATTTTTTTTTTTATATTTTCGAAGAATTTGGTTCAGTTTTTAGTGCAATTTACATAATGGAAACTCAAAAGTATGATTAAGATGGAAATTGGTAC
AGATTGTTATTTAACTTTTTATACGGGTTCATGTACTTACAGCATTAAGCCCCGAGTTGAAGACTACTTTGGATAAAGTTGTTACATCACACAAGGTCATCGTATTCATGAAGGGAACTA
AGGACTTCCCACAATGTGGCTTCTCAAACACAGTTGTTTCTATTTTGAAGGCGGTAAATGTACCGTTTGAAACAGTTAACATTCTTGAAAACGAAATGTTGCGTCAAGGGTTAAAGGAAT
ATTCACAGTGGCCAACATTTCCGCAACTTTACATTGATGGGGAGTTCTTTGGTGGTTGTGACATAACCGTTG
GTAAGTTAACTCACTTTTGGCTTTAAAACACGTCCATTTCGATGCATA
TTGTTCAATAGTTAATTACCGTCTCTTATTGCAGATGCATACAAGAGCGGGGAGTTGCAGGAAATATTGGAGAAGGCATCATTATCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCTCTATCACCTTTCACTCGCAATTGGCCTCCTCATCACGAATCCCCTCTTTCGAATTTGTTTCCCGTGCATCCACAATCAATCGCTCTGCACTGCGCTACCAACCTCGTACC
GCCACCTTTGGCACCTTAAAATTCAGCTCTCACGCTATTAGGACTGGAGTTCCTGCAAGAAGAATTGGATGCTTTGCTG
CATTAAGCCCCGAGTTGAAGACTACTTTGGATAAAGTTGTT
ACATCACACAAGGTCATCGTATTCATGAAGGGAACTAAGGACTTCCCACAATGTGGCTTCTCAAACACAGTTGTTTCTATTTTGAAGGCGGTAAATGTACCGTTTGAAACAGTTAACATT
CTTGAAAACGAAATGTTGCGTCAAGGGTTAAAGGAATATTCACAGTGGCCAACATTTCCGCAACTTTACATTGATGGGGAGTTCTTTGGTGGTTGTGACATAACCGTTG
ATGCATACAAG
AGCGGGGAGTTGCAGGAAATATTGGAGAAGGCATCATTATCCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCAGGCTTAT TAGAGGAGCC CATCCCATCA GTAACTTGCA AAATCTTCAA CATCGACGGC ATTTCATCGA ACACATCGTG TGCAGGTCGA TCCAAAATCC TCCATCTACC ACTGAACTTC  TGCAACATAA TCAGGTTGTA AACGATGTCG TCCTCTATCA CCTTTCACTC GCAATTGGCC TCCTCATCAC GAATCCCCTC TTTCGAATTT GTTTCCCGTG CATCCACAAT CAATCGCTCT  GCACTGCGCT ACCAACCTCG TACCGCCACC TTTGGCACCT TAAAATTCAG CTCTCACGCT ATTAGGACTG GAGTTCCTGC AAGAAGAATT GGATGCTTTG CTGCATTAAG CCCCGAGTTG  AAGACTACTT TGGATAAAGT TGTTACATCA CACAAGGTCA TCGTATTCAT GAAGGGAACT AAGGACTTCC CACAATGTGG CTTCTCAAAC ACAGTTGTTT CTATTTTGAA GGCGGTAAAT  GTACCGTTTG AAACAGTTAA CATTCTTGAA AACGAAATGT TGCGTCAAGG GTTAAAGGAA TATTCACAGT GGCCAACATT TCCGCAACTT TACATTGATG GGGAGTTCTT TGGTGGTTGT  GACATAACCG TTGATGCATA CAAGAGCGGG GAGTTGCAGG AAATATTGGA GAAGGCATCA TTATCCTGAT TGATTCAGGT TTGTATAAAC CCTCCATAAT TGTTGGAAAA CAAACTATAT  ACCATGTTCC ATATTCCATG TGTTATGTAT TTAAGTTTAT AATAACTCGA AGGAGGTTTA AGTTGATATT TATGAAAGGA CATGGTTCTA GTCACGTATC AGACTTTCAT ACAATGTTTC  TTTTCAAACC GACATCATGG TTTGTCGTTT CAGTATGCGA ATTTTATTTA TCTTTATAAG CATGTAACTA GCTAGTTCAT AAAACTGGCT AATTATGAAT CAGAAAAGCA ATCATTTGAT  CAGCCACATT CGGATCTGCT AATGTGCTTG TATTTGCAAG CTCAACTAGC TGCCTTGAAG CAACTTTCCT CAAAATTCTT GTTTTTGAAG ACCATATGTG CAATGGATTT TGTGAGGCCA 
GTGGCGGATC CAGAGGTGTT TTGGGGGTTC CCAGGAACCC CCTCGGTTTG GCAAAAAAT 

Retrieve as FASTA