Entry information : HaROXY11HanXRQChr04g0110161
Entry ID 14447
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaROXY11HanXRQChr04g0110161
Name HaROXY11HanXRQChr04g0110161
Class ROXY Grx    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaROXY11
start..stop
S start..stop
HaROXY10 89 7e-24 122..188 34..99
HaROXY10 81 1e-20 2..52 4..54
HaROXY30 80 3e-20 2..52 4..54
HaROXY30 78 1e-19 141..186 52..97
HaROXY29 78 2e-19 141..188 52..99
HaROXY29 76 6e-19 2..53 4..55
HaROXY12 77 3e-19 2..51 4..53
HaROXY12 74 4e-18 141..188 52..99
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 92419264..92419560 297 N° 2 92418286..92418555 270  
complement(join(92418286..92418555,92419264..92419560))


exon

Literature and cross-references HaROXY11HanXRQChr04g0110161
DNA ref. HanXRQ genome:   HanXRQChr04 (92419560..92418286)
Protein sequence: HaROXY11HanXRQChr04g0110161
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   188 (302)
PWM (Da):   %s   20660.74 (33562.0)  
PI (pH):   %s   9.18 (6.17) Peptide Signal:   %s   cut: 28 range:37-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVNALASQSDVVVFTKSTCIMCHSIKALFYYFGASPAVYEVDNDVDLEFSLQEWTTFSGDSCRRYWLKLSPVLTFSGDTSPVNGRRYWSDAIGLLSSLKDKDQRLGFGFRLRDADRPIAAIFGLSPLMVSPLKVVISCSVSLRRLGSNTAFPTVFVGGKYLGSTKEVISQHIDGTLKRKLIEAKAILL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAATGCTTTAGCTTCCCAGAGCGATGTCGTTGTCTTCACAAAAAGCACATGCATTATGTGCCATAGTATCAAGGCTCTCTTCTATTATTTTGGTGCAAGTCCTGCAGTTTATGAG
GTTGACAATGATGTTGATCTAGAGTTTTCACTACAAGAATGGACCACCTTTAGCGGCGACAGCTGTCGCCGGTATTGGTTAAAATTGTCGCCGGTATTGACCTTTAGCGGCGACACGTCG
CCGGTAAATGGTCGCCGGTATTGGTCGGACGCTATTGGCCTCCTGTCGTCGCTAAAG
GTCAGCGTCGCCGCTAATGTTTTTACCGGAGAATTGCCGGAAAGCTCGCCCGAGACCTGCAAA
TCTTCATAAACTCAAACAACAAAACATTTTACACAAATTTTTCATTCAAATCTCATGTATCATAAACTCAAACAAAGCATAAACACAAATTCCTCGCCGTGTTATCATTCAAATCTTATA
TATACATCCATAAACTCAAACAAATCCTTTTACATAAAATTACATTACACATTTTCTACATAAAACTAAAAAACAAGTCGGAGCTTGACGGAGAAGGTGCTCCGGTGACGAAGAAGACGG
TCATTTACGGTGGTGGTTGACGGTGGCGATGCAGGTGATTCTCCGGTGAAGATGCAGGTGCTCCGACGATGCTCCGGTAATGGTCCGGCGATGCTCTGGTTGTGAAGATGGCGGTGGTTG
CTTCACGGTGGTGGTGATCCGGTGGTGGTGGTAACAGGTTGTTGTTGTTGTGAAGATGATGGAGTTGGTGATTGTGTTTGTGTTTGTGTTTGTGGGTGAGTGTTTTTGTTGAAGGAAGAG
AAAGCAGGAAGGAACCTAAACCGTTGGATCATACTCTCATCAAGGGCAGAGATCAGCTCTTTTCAAGCTTCACACGGATTGACTTTTAGCGGAGACAACTGTCGCCGCTAATGCCTATTG
TCTTGTCGCCGCTAATGCCCTTTAAATCCCCAACCGTTAGATCAGGATAAGGATCAACGGCTGGGGTTTGGTTTCAGACTCCGGGATGCGGATCGACCAATAGCGGCGATATTTGGCCTG
TCGCCGCTAATGGTGTCGCCGCTAAAAGTGGTTATTTCTTGTAGTGTTTCCCTACGGAGGTTAGGTTCTAATACTGCGTTTCCAACCGTGTTTGTAGGTGGTAAATATCTGGGTTCTACT
AAAGAAGTTATTTCCCAACATATTGATGGCACTTTAAAGCGTAAGTTGATTGAAGCAAAGGCTATCTTGCTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAATGCTTTAGCTTCCCAGAGCGATGTCGTTGTCTTCACAAAAAGCACATGCATTATGTGCCATAGTATCAAGGCTCTCTTCTATTATTTTGGTGCAAGTCCTGCAGTTTATGAG
GTTGACAATGATGTTGATCTAGAGTTTTCACTACAAGAATGGACCACCTTTAGCGGCGACAGCTGTCGCCGGTATTGGTTAAAATTGTCGCCGGTATTGACCTTTAGCGGCGACACGTCG
CCGGTAAATGGTCGCCGGTATTGGTCGGACGCTATTGGCCTCCTGTCGTCGCTAAAG
GATAAGGATCAACGGCTGGGGTTTGGTTTCAGACTCCGGGATGCGGATCGACCAATAGCGGCG
ATATTTGGCCTGTCGCCGCTAATGGTGTCGCCGCTAAAAGTGGTTATTTCTTGTAGTGTTTCCCTACGGAGGTTAGGTTCTAATACTGCGTTTCCAACCGTGTTTGTAGGTGGTAAATAT
CTGGGTTCTACTAAAGAAGTTATTTCCCAACATATTGATGGCACTTTAAAGCGTAAGTTGATTGAAGCAAAGGCTATCTTGCTCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAATG CTTTAGCTTC CCAGAGCGAT GTCGTTGTCT TCACAAAAAG CACATGCATT ATGTGCCATA GTATCAAGGC TCTCTTCTAT TATTTTGGTG CAAGTCCTGC AGTTTATGAG  GTTGACAATG ATGTTGATCT AGAGTTTTCA CTACAAGAAT GGACCACCTT TAGCGGCGAC AGCTGTCGCC GGTATTGGTT AAAATTGTCG CCGGTATTGA CCTTTAGCGG CGACACGTCG  CCGGTAAATG GTCGCCGGTA TTGGTCGGAC GCTATTGGCC TCCTGTCGTC GCTAAAGGAT AAGGATCAAC GGCTGGGGTT TGGTTTCAGA CTCCGGGATG CGGATCGACC AATAGCGGCG  ATATTTGGCC TGTCGCCGCT AATGGTGTCG CCGCTAAAAG TGGTTATTTC TTGTAGTGTT TCCCTACGGA GGTTAGGTTC TAATACTGCG TTTCCAACCG TGTTTGTAGG TGGTAAATAT 
CTGGGTTCTA CTAAAGAAGT TATTTCCCAA CATATTGATG GCACTTTAAA GCGTAAGTTG ATTGAAGCAA AGGCTATCTT GCTCTAG 

Retrieve as FASTA