Entry information : HaCPF05 (HanXRQChr14g0460801)
Entry ID 14478
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCPF05 (HanXRQChr14g0460801)
Name (synonym) HaCPF05 (HanXRQChr14g0460801)
Class CPF Grx     [Orthogroup: CPF002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCPF05
start..stop
S start..stop
ThasCPF01 275 2e-94 7..193 113..299
AtCPF01 265 3e-90 7..189 103..285
ThasCPF04 261 1e-89 7..191 50..234
AtCPF04 256 1e-87 7..191 51..235
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 169732111..169732128 18 N° 2 169731889..169731975 87 N° 3 169731335..169731433 99 N° 4 169731152..169731254 103
N° 5 169730995..169731071 77 N° 6 169730704..169730811 108 N° 7 169730453..169730533 81 N° 8 169729839..169729850 12
complement(join(169729839..169729850,169730453..169730533,169730704..169730811,1 69730995..169731071,169731152..169731254,169731335..169731433,169731889..1697319 75,169732111..169732128))


exon

Literature and cross-references HaCPF05 (HanXRQChr14g0460801)
DNA ref. HanXRQ genome:   HanXRQChr14 (169732128..169729839)
Protein sequence: HaCPF05 (HanXRQChr14g0460801)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   194
PWM (Da):   %s   22387.49  
PI (pH):   %s   4.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSLNIGLQEKIKLVPIDLKNRPDWYKEKVYPANKVPALEHNNQVKGESLDLIKYIDTNFEGPSLYPDDTIKQEFGEELLSYTNTFYKAVTTSLKGDGFDDAAAAFDYIEKALSKFDDGPFFLGQFSVDIAYAPFIERFQPYLLDVKKYDIKVGRPKLAVWIEEMNKNDDFNQTRRDPKELVESYRKRYLSSS*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTATCTCTAAACATAGTGACATTTATATTTGAGATTGTTTTTTTTTTTGTATGTATTAGATGGAAATATTAACTCTCATCCGACCTCTTATGGATCAGCTCCCTTGGATGATTATGG
AATATTCATAATTTGTGTTTAAACTGTGTACAGGGATTGCAGGAAAAGATTAAACTGGTTCCAATTGATCTAAAGAACAGACCAGATTGGTACAAGGAGAAGGTTTACCCTGCAAACAAG
GTGATTCTCTTGCAAAAGTTTTATGCTTTCTACATGATTGTGCATACAGTTTGATTTACAGTCTTTTAAGTTTGGTTCAACCAAAAATCGGCATGCCTTTGCCCCCTGGCGTTTGACACG
TTCGGCTCCTTGGCGCCGGAGGCAGTTCGGTTCTTGTCTAGAGTTCAGCGCGTGGTCCACAGCAACTTTTCGACCCCTCAGGGGCGAGGCTTTGTTTTTAGTAGATTAGGGTTTTCTATT
CAGAAAGGGATGGCGGCGCAGTTTGTTGCTCGTCAACCTGCTATCCTTATGTAATTTGTCCTGATGATTGGAATGAAATAAAAATGCTAAATTCTTAACTAAAAAAAAAACCAAAAATGC
ACTTAATACAAACCACTAAGGTAATGCTTCGAAAAAATGCTATTTGTGATATGTCGATAAGAATAACTTGCCTTTGGTGTGTTCTTATGTCATAGGTGCCAGCTTTAGAACACAACAATC
AAGTCAAGGGAGAAAGTCTTGATCTCATCAAGTATATTGACACCAACTTTGAAGGACCGTCACTTTATCCAGAT
GTAAAGTTTCATATTATGGTTTGATTTTCAAAGGAATTAATATATT
TTGTTAATTATAACTATAGAACTACAATATATAGGATACTATCAAGCAAGAGTTTGGAGAAGAGTTGCTTTCATACACTAATACGTTCTATAAAGCCGTCACCACCTCATTAAAAGGAGA
CGGGTTTGATGATGCTG
GTATCTTAACTATCACTTTGTTTATCATCTTTCTATATTAAAAAAACAACATATAACATGGTCTTCAATAATCGCAACAGCTGCTGCATTTGATTATATAGAG
AAGGCTCTTTCCAAGTTCGATGATGGCCCATTTTTTCTAGGTCAATTCAGCCTG
GTAAGTATGATGAACGCCTAACCGAATTACAGTTATTTGCAACTGCTTCAACTGCTGATGTTGGTT
AATAGCTGTCTTCATTATATTCTATAAAGGTTTCTGTTTTCTTGAAAACATATTGCGTATGCATGCCTATTTATGATCCATTTGCGTATTTACGAACACATATATGTGCATGTACAGGTA
GATATAGCTTATGCTCCTTTCATCGAAAGATTTCAGCCGTACTTGCTAGATGTAAAAAAATACGATATTAAAGTGGGCCGGCCAAAACTTGCAGTCTGGATCGAG
GTACTACTCTTGCTT
TCACAATTGGTGGTGTATGCAAGATTTGTTGTACTTTCAAGTCTAGTGCTTTTGGTTTAAGTCTTTTGTAGAAAAGAAGAAATCACAATTCACACCTACGTTAGTCAACCTGCTTTTCTT
TACAAAACTCTTATCGCAGTTGGTTTCTCTTGCAGGAAATGAACAAAAACGATGATTTTAACCAAACCAGGCGGGATCCAAAGGAACTTGTAGAGAGCTACAGAAAACGTTATTTGGTAC
CGATTAACAGTCTCATACTCTCATGTCTTAAGTTTTTGTGTTCACCAAGTTGATATAAGCTAGGAACCATAGTTGTTAAAAGCCATCGCCTCTTGCGCCTAGGCCCAATTTCCTAGCGAA
GCGAGGCAATTGCGCCTTAAGTCAAGGCTCTTGCGCTTTAATTCTCCAAGTGATGGTTCATGCGCAGGTTCCGGCGAGATTCCTAGATTCTTGAGAGTTTTCGGCCAAATTCTCTAAATT
CTGAAAGGATTCTAGCTAGATTTCTACTTTTATCTAACGAAACTACTTTTCTACACTAATAAACTAGCATTTTATAACTTTTGGTAATAAATAGACGATATTAAATGTTATATAATAGCT
TTAGTTTATTTTATTTGAAGAATAGTATTAATTTTCTATTATATAAAAATATTTTATGTTTTTTTTGTTGTGCGCTTTTTTTTTCTCAGGCCCGCGCTTTTTTTGCGCTTTGCGCCTAGG
CCCCAGGAAAGGCCTATGCGCCTTGAGTGCGCTTAACGCTTTTAATAACTATGCTAGGAACTAAATACGTTAATAGCATGTTTATTCTTCTAAGTATCACGTGTTTGTGATCATGCAGTC
TTCATCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTATCTCTAAACATAGGATTGCAGGAAAAGATTAAACTGGTTCCAATTGATCTAAAGAACAGACCAGATTGGTACAAGGAGAAGGTTTACCCTGCAAACAAGGTGCCAGCTTTAGAA
CACAACAATCAAGTCAAGGGAGAAAGTCTTGATCTCATCAAGTATATTGACACCAACTTTGAAGGACCGTCACTTTATCCAGAT
GATACTATCAAGCAAGAGTTTGGAGAAGAGTTGCTT
TCATACACTAATACGTTCTATAAAGCCGTCACCACCTCATTAAAAGGAGACGGGTTTGATGATGCTG
CTGCTGCATTTGATTATATAGAGAAGGCTCTTTCCAAGTTCGATGATGGCCCA
TTTTTTCTAGGTCAATTCAGCCTG
GTAGATATAGCTTATGCTCCTTTCATCGAAAGATTTCAGCCGTACTTGCTAGATGTAAAAAAATACGATATTAAAGTGGGCCGGCCAAAACTTGCA
GTCTGGATCGAG
GAAATGAACAAAAACGATGATTTTAACCAAACCAGGCGGGATCCAAAGGAACTTGTAGAGAGCTACAGAAAACGTTATTTGTCTTCATCATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATATCAACAT ACTCTTTGCT ATGTTATCTC TAAACATAGG ATTGCAGGAA AAGATTAAAC TGGTTCCAAT TGATCTAAAG AACAGACCAG ATTGGTACAA GGAGAAGGTT TACCCTGCAA  ACAAGGTGCC AGCTTTAGAA CACAACAATC AAGTCAAGGG AGAAAGTCTT GATCTCATCA AGTATATTGA CACCAACTTT GAAGGACCGT CACTTTATCC AGATGATACT ATCAAGCAAG  AGTTTGGAGA AGAGTTGCTT TCATACACTA ATACGTTCTA TAAAGCCGTC ACCACCTCAT TAAAAGGAGA CGGGTTTGAT GATGCTGCTG CTGCATTTGA TTATATAGAG AAGGCTCTTT  CCAAGTTCGA TGATGGCCCA TTTTTTCTAG GTCAATTCAG CCTGGTAGAT ATAGCTTATG CTCCTTTCAT CGAAAGATTT CAGCCGTACT TGCTAGATGT AAAAAAATAC GATATTAAAG  TGGGCCGGCC AAAACTTGCA GTCTGGATCG AGGAAATGAA CAAAAACGAT GATTTTAACC AAACCAGGCG GGATCCAAAG GAACTTGTAG AGAGCTACAG AAAACGTTAT TTGTCTTCAT  CATAAGGTTC AGGTTTTGCG ATTCAGTCAC GCCATGGGAT GCAGGAACAT TGCATGGACA AGAAGACCTG ATTAGTTCCT TTGGATATTT AAGAATAATA TGTTACATAG GTTATTTGTG 
CAACATACTA TTGACAAAAT AAAACTATGT TATTATGTTT AATCTATTTT CTAATATGCT ACAATTTTGT GGTCGATTAT ACATTTATAC AACATGCATC TATTATTTA 

Retrieve as FASTA