Entry information : HaLilium02HanXRQChr05g0156071
Entry ID 14484
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaLilium02HanXRQChr05g0156071
Name HaLilium02HanXRQChr05g0156071
Class Thioredoxin Type Lilium    [Orthogroup: Lilium004]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaLilium02
start..stop
S start..stop
ThasLilium03-2 235 5e-78 30..243 42..245
HaLilium05 231 4e-76 12..218 19..233
AtLilium03 229 6e-76 65..219 68..222
HaLilium01 229 1e-75 63..218 77..232
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 192028816..192029001 186 N° 2 192029112..192029294 183 N° 3 192029385..192029549 165 N° 4 192030252..192030452 201
join(192028816..192029001,192029112..192029294,192029385..192029549,192030252..1 92030452)


exon

Literature and cross-references HaLilium02HanXRQChr05g0156071
DNA ref. HanXRQ genome:   HanXRQChr05 (192028816..192030452)
Protein sequence: HaLilium02HanXRQChr05g0156071
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   244
PWM (Da):   %s   26831.7  
PI (pH):   %s   8.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSLNSIILPGYLTSFKETLINPNGSLSSSVFPTDLTQRSQLFSDHKGLTSSSWNAKTPVLAHASICVSKSMRWWEKTLKPNMIEINSAQEFVDTLSNSGDRLVIVDFYSPGCGGCKALYPKICQLAESNPKAIFLQVNYEELKPMCQSLHIHVLPFFRFYKGHEGKICSFSCTVATIKKFKDALSKYKPDGCNLGPAKGLEESELLTLASIGQISYNLPLKSTEVDLDPKKMNPSSKNLLLA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCATTAAACTCCATTATTTTGCCTGGTTATTTGACTTCTTTTAAAGAAACTTTAATAAACCCAAATGGGTCTCTTTCTTCTTCAGTTTTCCCCACTGATTTGACCCAAAGA
TCACAGCTTTTTTCAGATCACAAGGGTTTAACTTCAAGTTCTTGGAATGCCAAAACCCCTGTTCTT
GTATGTTAAATATTATCATTTTTTTTCTTTTGTGAAATGGGGTTTGTGTTTAAA
GTTTTAAACATTATTTTGATTTCTGATAGAAATTTTCTATTTTCATGACTATACAGGCACATGCTTCAATATGTGTTAGCAAATCAATGAGATGGTGGGAAAAGACATTAAAGCCCAACA
TGATTGAGATCAATTCAGCCCAAGAGTTTGTGGATACACTATCAAATTCAGGGGATAGATTGGTCATTGTGGACTTTTATTCACCTGGTTGTGGTGGTTGTAAAGCTCTATATCCCAAG
G
TATGAACTATTTAAAATCCTATCTTTTTTTTTTTCTCAAGATTTTAGTGATTATTTTTTTAATTGATTTATTTTTGGGTTTATAATCAGATCTGTCAATTAGCTGAGTCAAACCCTAAAG
CAATTTTCCTCCAAGTGAACTATGAAGAACTCAAACCCATGTGTCAATCTCTCCATATTCATGTTCTGCCATTTTTTAGATTCTACAAAGGTCATGAGGGCAAGATTTGCAGCTTTAGCT
GCACTGTTGCAACT
GTAAGTTTTTTTTTTTTTTTTTTTTCATTTTAATTTTGAATGCAATGTTGAAATGCTTAGACTTGAGCTATATTAAATTAAATGTCAAAAAAAAAAAAAAAAGATT
TTCAAGGTTGAATGGATCAATTGGGCAAACATTAGTTGTAAACTTGTAATGTATACAAGCTTTTGAATTTGTTAATTGAAAAGAATAAGATTATAAGTACAATAATAGATTTTTTTATTG
TCATATTGGATATATTTATAATTTATAATTTTTTATATAATTTAAGACAGTTAAAAAGTTGTGGGTTCAGTGGCGAAGCTTGAGATTTCCGACCGGTGGTCGAAAACGTATATACACACA
AATTTCTATAAAACCGGGGGGTCAAAAACTTGTATACCTAAAAATTTCTATACGAAAACTATATATTTTTCACCACTGAGAGAAAAGTTCGGGGGGTCGGTCCCCCTCCCACCCCTACTA
TGCTACGCCCATGCGTGGGTTGATTCATCCCATGTTAACTGAGGAGGTTAATGGGCCGGGTATTGGTAATCTTGTCAGATTGGTAATCCTGTCGGGCTTATCCATCGACTGGTCCCATAC
CCGAACACCCTATTTATCCAAACCTTTTTTGTTTTAATATGTTAATGATACCTCTAATTTCTGTTATCCAAAAAGAATGATGACAAAAGTTAACAAGAATAATTGGTTAATGGCAGATCA
AGAAATTCAAGGATGCATTATCAAAGTACAAGCCAGATGGATGTAATCTTGGTCCAGCTAAAGGATTAGAAGAGTCTGAGCTGTTGACTTTAGCTTCAATTGGTCAAATTTCTTATAATT
TGCCATTAAAGTCAACTGAGGTTGATTTGGATCCTAAGAAAATGAACCCATCCAGCAAGAATTTGCTTCTTGCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCATTAAACTCCATTATTTTGCCTGGTTATTTGACTTCTTTTAAAGAAACTTTAATAAACCCAAATGGGTCTCTTTCTTCTTCAGTTTTCCCCACTGATTTGACCCAAAGA
TCACAGCTTTTTTCAGATCACAAGGGTTTAACTTCAAGTTCTTGGAATGCCAAAACCCCTGTTCTT
GCACATGCTTCAATATGTGTTAGCAAATCAATGAGATGGTGGGAAAAGACATTA
AAGCCCAACATGATTGAGATCAATTCAGCCCAAGAGTTTGTGGATACACTATCAAATTCAGGGGATAGATTGGTCATTGTGGACTTTTATTCACCTGGTTGTGGTGGTTGTAAAGCTCTA
TATCCCAAG
ATCTGTCAATTAGCTGAGTCAAACCCTAAAGCAATTTTCCTCCAAGTGAACTATGAAGAACTCAAACCCATGTGTCAATCTCTCCATATTCATGTTCTGCCATTTTTTAGA
TTCTACAAAGGTCATGAGGGCAAGATTTGCAGCTTTAGCTGCACTGTTGCAACT
ATCAAGAAATTCAAGGATGCATTATCAAAGTACAAGCCAGATGGATGTAATCTTGGTCCAGCTAAA
GGATTAGAAGAGTCTGAGCTGTTGACTTTAGCTTCAATTGGTCAAATTTCTTATAATTTGCCATTAAAGTCAACTGAGGTTGATTTGGATCCTAAGAAAATGAACCCATCCAGCAAGAAT
TTGCTTCTTGCATAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTCACAAC TATTTTGTGA GTGGATAAAG TTGAATTTAA TGAAACTGAA AACCCTACAT AAAACCAAAA AAAGATCCCA CCAAACCTGT TACTTTTCCT TTTCCCAAAA CCTTCATCCA  CACTTCTCTC TCATCAAAGG AACACATCTT TTGTTGGTTT TTTGGTCTTC TTGCACCAAG TTATGTTATT TGGATTCTTG TTAACTGGAT TACATAAAAC CTCAATTGGT CTTTTGTCTT  GCTTCACATC ATACTAACAA AAAAAGGGTT CTTGCCTTCT TGGTGCATTC TTCAATCTTT TATCTTTAAC ATCTCTCCAA TGGCTTCTTC ATTAAACTCC ATTATTTTGC CTGGTTATTT  GACTTCTTTT AAAGAAACTT TAATAAACCC AAATGGGTCT CTTTCTTCTT CAGTTTTCCC CACTGATTTG ACCCAAAGAT CACAGCTTTT TTCAGATCAC AAGGGTTTAA CTTCAAGTTC  TTGGAATGCC AAAACCCCTG TTCTTGCACA TGCTTCAATA TGTGTTAGCA AATCAATGAG ATGGTGGGAA AAGACATTAA AGCCCAACAT GATTGAGATC AATTCAGCCC AAGAGTTTGT  GGATACACTA TCAAATTCAG GGGATAGATT GGTCATTGTG GACTTTTATT CACCTGGTTG TGGTGGTTGT AAAGCTCTAT ATCCCAAGAT CTGTCAATTA GCTGAGTCAA ACCCTAAAGC  AATTTTCCTC CAAGTGAACT ATGAAGAACT CAAACCCATG TGTCAATCTC TCCATATTCA TGTTCTGCCA TTTTTTAGAT TCTACAAAGG TCATGAGGGC AAGATTTGCA GCTTTAGCTG  CACTGTTGCA ACTATCAAGA AATTCAAGGA TGCATTATCA AAGTACAAGC CAGATGGATG TAATCTTGGT CCAGCTAAAG GATTAGAAGA GTCTGAGCTG TTGACTTTAG CTTCAATTGG  TCAAATTTCT TATAATTTGC CATTAAAGTC AACTGAGGTT GATTTGGATC CTAAGAAAAT GAACCCATCC AGCAAGAATT TGCTTCTTGC ATAGGTTTTA GATGCTAGTT TGAAAACAGT  GTCTTTGCAA GAATTTACTT GTTTAGGTTT TAGATTAATC TATCCGAACC CTAATGGGTC GGGTCGGTGG GCATTTAAGT GGGCTTGCTA TATTTTTAGT TGATGGACAA GCCCTACTTG  TTTGATGTTT GTTCAGTTTA TTATTGAAGA TTGTAATTTG TGATTGACTA GACCCGTGCG TGTTGCGGCG CGGGTACATC ATAAACATCG AATCGATTAG TTCAATCGTT ATGCGATGCG  TTAACCATAT GAAAACACGT ATTTCGACGT ATTCAATTGA ACTCAATGCA ACCTATATAA GCATTGCGAT TGTATCAAAA TGTAAAGTAA ATCGAGTTTA TAACGTACAA TCATAACGTA  TTATATGTGA CCCAACTCGT ACATAGAAAA TGTAACGGGT ATAAAAGGAA AAACTGCCAC GTGTAATCAA AAGCGATTAA TTAGAGCTTT TGAATCAAAA AACCACAACT TAACTCCACT 
CGGTTCGAAA CAAAATTTCG TAACATTCAT AAAATAGGCA TAAAAATATA TTATATATGA CCTGACTCGT TTCCTAAAAA AGTTTAGGTC GAATCGTTGA CCAATTCTAA TTTATACCA 

Retrieve as FASTA