Entry information : HaLilium03HanXRQChr09g0267601
Entry ID 14485
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaLilium03HanXRQChr09g0267601
Name HaLilium03HanXRQChr09g0267601
Class Thioredoxin Type Lilium    [Orthogroup: Lilium003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaLilium03
start..stop
S start..stop
HaLilium06 289 8e-101 1..196 15..214
ThasLilium06 214 5e-71 68..197 82..211
AtLilium06 213 1e-70 72..198 89..215
AtLilium05 64 0.0000000000005 85..195 97..200
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 179780652..179781086 435 N° 2 179780416..179780469 54 N° 3 179780177..179780308 132  
complement(join(179780177..179780308,179780416..179780469,179780652..179781086))


exon

Literature and cross-references HaLilium03HanXRQChr09g0267601
DNA ref. HanXRQ genome:   HanXRQChr09 (179781086..179780177)
Protein sequence: HaLilium03HanXRQChr09g0267601
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   206
PWM (Da):   %s   23500.72  
PI (pH):   %s   5.62
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIHHTPPLQVKNWKTAEFNTPSSPLLDKSFMRRWHLKDTTTPCDNRGPVLQYHRPLIDYQSVHCTASGDPLDEDDELCPVECVREIKRDEELLAVVEKAKNDNTLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDEEAAVIFLKHNVIDEYDEQSDIAERLRIKTVPLFHFYKDGMLLEAFPTRDKERIRAAIEKYTSPIPAASQNA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCACCACACTCCTCCTTTACAAGTTAAAAACTGGAAAACAGCAGAATTTAATACCCCCTCTTCTCCTCTTCTGGATAAAAGCTTCATGAGAAGATGGCATTTGAAAGATACAACA
ACTCCATGTGATAACAGAGGTCCAGTGTTACAATATCATAGGCCTCTGATCGACTACCAGTCGGTCCACTGTACGGCTAGTGGGGACCCGCTAGATGAAGATGATGAGCTCTGTCCCGTT
GAATGTGTTAGAGAAATAAAAAGGGACGAGGAACTACTTGCAGTTGTTGAAAAAGCAAAAAACGATAATACATTGGTTGTGGTCGATTTCTACCGTACTTCGTGTGGTAGTTGCAAATAT
ATCGAACAGGGTTTTGCTAAATTGTGCAAAGGGTCTGGTGATGAAGAGGCTGCAGTCATATTCTTAAAGCATAAT
GTGAGTTCGGTTCATTTCATATTCCTGTCCTGTTACTTATAAAAC
ACTTGCATCGTCGGTTGTTTTGTTTCATCAAAGTGCCCCGAGTTGACTTATGATAGTCAAACTCAAACAAACTGCTTTTAAACTTCAAGTTTAAACAAACTGCTTTTAAACTAATGCTCT
TGTGATGTATGATACAGGTGATTGACGAATATGATGAGCAATCAGATATAGCAGAACGACTTCGAATTAAGGTATGTAAATTTCCCTTGTTTCTTCATAAATTTTTTGTTTGCTGGTTAT
AATATAATTGGTGTATTCTTCGTACAAAATTTGGGATTTATTTTGATATAATACACAGACGGTGCCTCTTTTTCATTTCTATAAAGATGGAATGCTATTGGAAGCTTTTCCTACCCGAGA
TAAGGAGCGGATTAGAGCGGCTATAGAGAAATACACATCACCTATTCCTGCTGCGTCTCAAAACGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCACCACACTCCTCCTTTACAAGTTAAAAACTGGAAAACAGCAGAATTTAATACCCCCTCTTCTCCTCTTCTGGATAAAAGCTTCATGAGAAGATGGCATTTGAAAGATACAACA
ACTCCATGTGATAACAGAGGTCCAGTGTTACAATATCATAGGCCTCTGATCGACTACCAGTCGGTCCACTGTACGGCTAGTGGGGACCCGCTAGATGAAGATGATGAGCTCTGTCCCGTT
GAATGTGTTAGAGAAATAAAAAGGGACGAGGAACTACTTGCAGTTGTTGAAAAAGCAAAAAACGATAATACATTGGTTGTGGTCGATTTCTACCGTACTTCGTGTGGTAGTTGCAAATAT
ATCGAACAGGGTTTTGCTAAATTGTGCAAAGGGTCTGGTGATGAAGAGGCTGCAGTCATATTCTTAAAGCATAAT
GTGATTGACGAATATGATGAGCAATCAGATATAGCAGAACGACTT
CGAATTAAG
ACGGTGCCTCTTTTTCATTTCTATAAAGATGGAATGCTATTGGAAGCTTTTCCTACCCGAGATAAGGAGCGGATTAGAGCGGCTATAGAGAAATACACATCACCTATTCCT
GCTGCGTCTCAAAACGCCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGCGAGT GGTGGATAGG ATAGGATAGT AGATCCAAAA CCAAAAGTGT GTGGTGATTG ATGAGTTTGT AGCTTTGTGC TGTTACTTTC TCATCACCCT ATTGCTCCGT CACCTGAGAG  CTACAGTTTC AGCCCATCGT AATCTGATCA TTGCGTCTGT CTGCAATCTG GATCAACCTA CATTCATCAC AAAGGTGTAT GATCATCGCA TTTCATGCTG CTCACTTTAG ACATAAAAGT  TTCCTTCAAA TTGTGGACAT CAAAGTGATT TGTGAAGCAT AGAATATAAT AGAATCATGA TCCACCACAC TCCTCCTTTA CAAGTTAAAA ACTGGAAAAC AGCAGAATTT AATACCCCCT  CTTCTCCTCT TCTGGATAAA AGCTTCATGA GAAGATGGCA TTTGAAAGAT ACAACAACTC CATGTGATAA CAGAGGTCCA GTGTTACAAT ATCATAGGCC TCTGATCGAC TACCAGTCGG  TCCACTGTAC GGCTAGTGGG GACCCGCTAG ATGAAGATGA TGAGCTCTGT CCCGTTGAAT GTGTTAGAGA AATAAAAAGG GACGAGGAAC TACTTGCAGT TGTTGAAAAA GCAAAAAACG  ATAATACATT GGTTGTGGTC GATTTCTACC GTACTTCGTG TGGTAGTTGC AAATATATCG AACAGGGTTT TGCTAAATTG TGCAAAGGGT CTGGTGATGA AGAGGCTGCA GTCATATTCT  TAAAGCATAA TGTGATTGAC GAATATGATG AGCAATCAGA TATAGCAGAA CGACTTCGAA TTAAGACGGT GCCTCTTTTT CATTTCTATA AAGATGGAAT GCTATTGGAA GCTTTTCCTA  CCCGAGATAA GGAGCGGATT AGAGCGGCTA TAGAGAAATA CACATCACCT ATTCCTGCTG CGTCTCAAAA CGCCTAGGGC ATTCTGGTAA TATGGTTATA CTTAGCTAGC AATTTGCAGA  TAATTCTTTG CATGGTGCTA TATATATATA ATTGATAATG ATAATTCAAC CCATGTTGCA TTGTAACATA TAGAGATTGT ATTCCATCAG TATAAGATAT TACTCATTTT TGTCATTTAA 
TATTCCTATT TTGTGGGCTA CAAAGTAGAC AGAGATAAAT GAGACCATGA TATAAATGAA TAAAAGCATA TTTTGTGACA GGAAAAATCA AATACATATT TGTT 

Retrieve as FASTA