Entry information : HaLilium06HanXRQChr14g0439631
Entry ID 14488
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaLilium06HanXRQChr14g0439631
Name HaLilium06HanXRQChr14g0439631
Class Thioredoxin Type Lilium    [Orthogroup: Lilium003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaLilium06
start..stop
S start..stop
HaLilium03 296 1e-103 15..219 1..201
ThasLilium06 223 1e-74 80..215 76..211
AtLilium06 219 8e-73 87..215 86..214
ThasTrxH01 62 0.0000000000004 114..215 21..114
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 96066109..96066597 489 N° 2 96066886..96066939 54 N° 3 96067039..96067164 126  
join(96066109..96066597,96066886..96066939,96067039..96067164)


exon

Literature and cross-references HaLilium06HanXRQChr14g0439631
DNA ref. HanXRQ genome:   HanXRQChr14 (96066109..96067164)
Protein sequence: HaLilium06HanXRQChr14g0439631
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222
PWM (Da):   %s   25336.85  
PI (pH):   %s   7.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSWSIQTSLQKHRTMIHQTLISFPKVNIQNTQTEFKNPSTFPDKCSMRACRLKEQTRCDNRGAVSHYRRLQIHSQRVECVANGDPQELLDEDEELCPVECVREIKKDEELLTVLEKAKKANTLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDEEAAVIFLKHNVIDEYDEQSDIAERLRIKTVPLFHFYKNGILLEAFPTRDKERIKAAIEKYTAPAPAPAA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTGGTCCATACAAACTTCATTGCAGAAGCATAGAACCATGATTCACCAAACCCTGATAAGTTTTCCTAAAGTTAACATTCAGAACACGCAAACCGAGTTTAAAAACCCGTCAACT
TTTCCGGATAAATGTTCCATGAGAGCATGCCGCTTGAAGGAACAAACTCGGTGTGATAACAGAGGCGCGGTTTCACACTATCGTAGGCTGCAGATCCACTCTCAGCGAGTCGAGTGTGTG
GCGAACGGGGACCCACAAGAGTTGTTAGATGAAGATGAGGAGCTCTGCCCCGTCGAATGTGTCAGAGAAATCAAGAAGGATGAGGAACTACTCACAGTTCTAGAGAAAGCGAAAAAGGCT
AATACATTGGTTGTGGTCGACTTCTATCGCACTTCATGTGGTAGTTGCAAGTATATTGAACAGGGTTTCGCAAAATTGTGCAAAGGGTCAGGTGATGAGGAGGCTGCAGTTATCTTCTTA
AAGCATAAT
GTGAGTTTTGCTCATCTCTATTACTGTTTTGCTTAAACAATGTCCGCGGGTGTTTTATATCTTTATGATCATGTCAGAACTATTTCCCGCATATAGCCATGAGATATGCCA
AGTTTTAGTTGCGTATCTACTTTTATTCGCGTATATGCCTGATAATAACACAAAATGATTCTACAAATGCATACTATGCTGATAAGATTCGAATATCTACCTTCTTGTACTCGAGTGTCC
TTAAAGTAACTATTTTATCTACTCGTGTAACTCATGGTTTTGTGATACATTCTGCAGGTGATTGATGAATATGATGAGCAATCGGATATAGCAGAACGACTTCGAATTAAGGTGCTATAT
ATTTAACATGTTCAAAATTCCTTCCTCCAAAGTCCAAATATTATTTTTCTCGGTTATTCTGTAATCTGAGTTTATTTTCAATTATAACAGACGGTTCCTCTCTTTCATTTCTATAAAAAT
GGGATCCTATTGGAAGCTTTTCCTACCAGAGATAAGGAACGGATTAAAGCGGCTATAGAAAAATATACAGCCCCTGCACCGGCTCCTGCTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTGGTCCATACAAACTTCATTGCAGAAGCATAGAACCATGATTCACCAAACCCTGATAAGTTTTCCTAAAGTTAACATTCAGAACACGCAAACCGAGTTTAAAAACCCGTCAACT
TTTCCGGATAAATGTTCCATGAGAGCATGCCGCTTGAAGGAACAAACTCGGTGTGATAACAGAGGCGCGGTTTCACACTATCGTAGGCTGCAGATCCACTCTCAGCGAGTCGAGTGTGTG
GCGAACGGGGACCCACAAGAGTTGTTAGATGAAGATGAGGAGCTCTGCCCCGTCGAATGTGTCAGAGAAATCAAGAAGGATGAGGAACTACTCACAGTTCTAGAGAAAGCGAAAAAGGCT
AATACATTGGTTGTGGTCGACTTCTATCGCACTTCATGTGGTAGTTGCAAGTATATTGAACAGGGTTTCGCAAAATTGTGCAAAGGGTCAGGTGATGAGGAGGCTGCAGTTATCTTCTTA
AAGCATAAT
GTGATTGATGAATATGATGAGCAATCGGATATAGCAGAACGACTTCGAATTAAGACGGTTCCTCTCTTTCATTTCTATAAAAATGGGATCCTATTGGAAGCTTTTCCTACC
AGAGATAAGGAACGGATTAAAGCGGCTATAGAAAAATATACAGCCCCTGCACCGGCTCCTGCTGCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAACAATATT CAAAATTATG ATTTTTCAAC TGTGGAATAT TGGAGCGAGT GGCTGATATG AGCTGCAGAA GTGTGCGGTG ATGAATGTAA CTGACTTTTG CTCTCATTTT ATCGTCAACA  ACAACTGCTC CGCCGTCGCC ACCGCTTCCC TCCGCCGCCT AACAGTTGAT GTTTCAAAAA TAAGTTGTGC ATTATCCTTG GTTTTTGCAA GATACAAGGG GTGAAGAACA TCTGCCACCT  CTCTTCTCTG GGTTTTTAGC ACAGTAAATC CAATGTCTTG GTCCATACAA ACTTCATTGC AGAAGCATAG AACCATGATT CACCAAACCC TGATAAGTTT TCCTAAAGTT AACATTCAGA  ACACGCAAAC CGAGTTTAAA AACCCGTCAA CTTTTCCGGA TAAATGTTCC ATGAGAGCAT GCCGCTTGAA GGAACAAACT CGGTGTGATA ACAGAGGCGC GGTTTCACAC TATCGTAGGC  TGCAGATCCA CTCTCAGCGA GTCGAGTGTG TGGCGAACGG GGACCCACAA GAGTTGTTAG ATGAAGATGA GGAGCTCTGC CCCGTCGAAT GTGTCAGAGA AATCAAGAAG GATGAGGAAC  TACTCACAGT TCTAGAGAAA GCGAAAAAGG CTAATACATT GGTTGTGGTC GACTTCTATC GCACTTCATG TGGTAGTTGC AAGTATATTG AACAGGGTTT CGCAAAATTG TGCAAAGGGT  CAGGTGATGA GGAGGCTGCA GTTATCTTCT TAAAGCATAA TGTGATTGAT GAATATGATG AGCAATCGGA TATAGCAGAA CGACTTCGAA TTAAGACGGT TCCTCTCTTT CATTTCTATA  AAAATGGGAT CCTATTGGAA GCTTTTCCTA CCAGAGATAA GGAACGGATT AAAGCGGCTA TAGAAAAATA TACAGCCCCT GCACCGGCTC CTGCTGCTTA ATAAAACAAG ACGATCCGGT  AATGTGCCTA AATTTTGCCA CCTGCAGATC ATAGTTTAGA TACAACTTGC ATGGTGTTAT ATGTAATTCA ATCCATGCTA ATGTTTTTAA TTTTGTAGGC TACAAAATAA AGAATGAAAA 
ATTAATCATT ATGTATAAAT GAATAAAACT ATATATTTGT 

Retrieve as FASTA