Entry information : HaTrx01 (HanXRQChr01g0010601)
Entry ID 14489
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2018-03-08 (Christophe Dunand)
Peroxidase information: HaTrx01 (HanXRQChr01g0010601)
Name (synonym) HaTrx01 (HanXRQChr01g0010601)
Class Other Thioredoxin    [Orthogroup: Trx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrx01
start..stop
S start..stop
HaTrx07 302 7e-107 1..188 1..187
AtTrx08 209 1e-69 1..188 26..210
ThasTrx08 202 3e-67 1..188 1..193
AtTrx07 155 2e-48 71..186 73..188
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 69965176..69965483 308 N° 2 69964611..69964685 75 N° 3 69964366..69964432 67 N° 4 69964248..69964265 18
N° 5 69964054..69964152 99  
complement(join(69964054..69964152,69964248..69964265,69964366..69964432,6996461 1..69964685,69965176..69965483))


exon

Literature and cross-references HaTrx01 (HanXRQChr01g0010601)
DNA ref. HanXRQ genome:   HanXRQChr01 (69965483..69964054)
Protein sequence: HaTrx01 (HanXRQChr01g0010601)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   188
PWM (Da):   %s   21795.29  
PI (pH):   %s   9.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSILSPNSHLLYRELHHRDLQQPQQPNWSNGCCSNLTKTCGFGFDRIKFDQSKRIVKRDCKAAAFWDLSRPAFVEMEPITDSDHLDIILEKAKQASQPILIDWMATWCRKCIYLKPKLEKLAAEYDTKLKIYYVDVNKVPQTLVKRGKIKMPTIQLWKDGEMKAEVIGGHKAWLVIEEVREMIKNFV*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAATTTTATCACCAAATTCTCATCTTCTTTACCGAGAACTCCATCACAGAGACCTGCAACAGCCACAACAACCAAATTGGAGTAATGGGTGTTGCTCAAATCTCACAAAAACTTGT
GGGTTTGGTTTTGATCGAATAAAATTTGATCAATCAAAGAGAATTGTGAAAAGAGACTGTAAAGCTGCAGCCTTTTGGGACCTGTCAAGACCAGCTTTTGTGGAAATGGAGCCGATCACT
GATTCTGATCATCTGGATATTATTTTGGAAAAAGCTAAACAAGCTTCTCAACCCATTCTCATTGATTG
GTATATATTTTTTTCTCATTTTCTTTTGCCTGATTTGATTATTAAGTTTTCA
TGTATGAATATGATCGTTTTCGAGCGTGAGTCAACACGCGTCCCACTTTTCGTGTCCAATATTGTATGGTATAATATGATACGTGTGACACAGAAAGTGGGACGTCATGCTTGAAAAGTT
ACAGGTATTAAAGATTGTGTAAGAATTCAACATGTGTCCCACTTTCTGTGTCGGGTACCTATACGGTATGATATATTATTAGTTGTACCGTATAGGTAGTGGAGACGGAGAAAGTGGGCA
CTAATCTCTGTTTTGAGGTACTACGATTGTGTAAGAGTCCACGTGTCCCACTTTCTACGTCGAATACTTGTACAAGATAAGATATTATTAGTTGTACGGTACAAGTAGTCGAGAGTGAGA
AAGTGGGGACGTTCGCTCTGTTTTGAGGTATTAAAGTTGTTTGAAGAATGCATGGTGAATAATTTGTATTGTGTGTAGGATGGCTACTTGGTGCAGAAAATGCATATATTTGAAGCCTAA
ATTGGAAAAATTGGCAGCAGAATATGATACCAA
GTACTTTCACCAAATTATTTGTTATTTAAATAGTTCAATTTGATTCTACTTTTGTTAAAAAAAAAAAAAAAAAAAAGCACATGGTTA
GCTTATACTATGTTTTAACTTTTAAGCTTTTCTTTTAGTTATCTTACATGGTATTGACAAACCTTTCTTCGACTCGTGGATTCTTAAACAGACTCAAAATTTATTACGTGGATGTGAATA
AAGTACCACAAACTCTCGTGAAACGTGGGAAGATATCC
GTACGTCAAATTTTCCAAATTTAAATTCGACAAATCTTGTTGGTTTTGATGTTGCTAACAATTCACTTCATCGTCTTGTTTA
TGTTGTTTGTTGATACAGAAAATGCCAACAATTCAGGTGAGTTTTAGATCATCTTGACTAAATTTTAGTCAGCTGTGTAAGGTAAGTAAAAATGTTTTGGTTCTGAACTCTTAGATGTTA
CATTCATGTAGTTGTGGAAAGATGGCGAGATGAAAGCAGAAGTAATTGGCGGGCATAAAGCATGGCTTGTGATCGAAGAAGTTAGAGAAATGATCAAGAATTTTGTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAATTTTATCACCAAATTCTCATCTTCTTTACCGAGAACTCCATCACAGAGACCTGCAACAGCCACAACAACCAAATTGGAGTAATGGGTGTTGCTCAAATCTCACAAAAACTTGT
GGGTTTGGTTTTGATCGAATAAAATTTGATCAATCAAAGAGAATTGTGAAAAGAGACTGTAAAGCTGCAGCCTTTTGGGACCTGTCAAGACCAGCTTTTGTGGAAATGGAGCCGATCACT
GATTCTGATCATCTGGATATTATTTTGGAAAAAGCTAAACAAGCTTCTCAACCCATTCTCATTGATTG
GATGGCTACTTGGTGCAGAAAATGCATATATTTGAAGCCTAAATTGGAAAAA
TTGGCAGCAGAATATGATACCAA
ACTCAAAATTTATTACGTGGATGTGAATAAAGTACCACAAACTCTCGTGAAACGTGGGAAGATATCCAAAATGCCAACAATTCAGTTGTGGAAAGAT
GGCGAGATGAAAGCAGAAGTAATTGGCGGGCATAAAGCATGGCTTGTGATCGAAGAAGTTAGAGAAATGATCAAGAATTTTGTATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTATAATT TTCACTCTTT TTCTCCTCAA TCAAAACATC CACTTTCAAT CCAAAAAGCC TCAAAATCCT TCAATACAAA ATAATTGTTT TCAATAAATC ATTCTGGGCC TAAAATATCT  TATCTTTTCA AAGTTTATCA AAACCAGAAA ACAAACACAG TCGAAAAAAT GTCAATTTTA TCACCAAATT CTCATCTTCT TTACCGAGAA CTCCATCACA GAGACCTGCA ACAGCCACAA  CAACCAAATT GGAGTAATGG GTGTTGCTCA AATCTCACAA AAACTTGTGG GTTTGGTTTT GATCGAATAA AATTTGATCA ATCAAAGAGA ATTGTGAAAA GAGACTGTAA AGCTGCAGCC  TTTTGGGACC TGTCAAGACC AGCTTTTGTG GAAATGGAGC CGATCACTGA TTCTGATCAT CTGGATATTA TTTTGGAAAA AGCTAAACAA GCTTCTCAAC CCATTCTCAT TGATTGGATG  GCTACTTGGT GCAGAAAATG CATATATTTG AAGCCTAAAT TGGAAAAATT GGCAGCAGAA TATGATACCA AACTCAAAAT TTATTACGTG GATGTGAATA AAGTACCACA AACTCTCGTG  AAACGTGGGA AGATATCCAA AATGCCAACA ATTCAGTTGT GGAAAGATGG CGAGATGAAA GCAGAAGTAA TTGGCGGGCA TAAAGCATGG CTTGTGATCG AAGAAGTTAG AGAAATGATC  AAGAATTTTG TATGATTTTT TCTTTATTTT CGGTTAAATT TTTGTTCATG TATATTTTCA TATCATAAAA TAACCAATAT TTATGTACAG TTTTTTAATT CGTTTTACCA GTACGATATG  TATTCTTTTT GTTCCAAACA AATGTGCAGG TCTTTTATCG TCTTAAGTAA CACTAAGTGG CTAAATTTGA GACACAATTC AACATCGTAA GATAATATAT TAGGAACTAT CATATCACCA 
ATCAATGTGT 

Retrieve as FASTA