Entry information : HaTrx02 (HanXRQChr05g0146641)
Entry ID 14490
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-03-08 (Christophe Dunand)
Peroxidase information: HaTrx02 (HanXRQChr05g0146641)
Name (synonym) HaTrx02 (HanXRQChr05g0146641)
Class Other Thioredoxin    [Orthogroup: Trx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrx02
start..stop
S start..stop
AtTrx02 388 4e-136 44..346 2..302
ThasTrx02 380 5e-133 117..345 82..311
HaTrxH08 70 0.000000000000004 232..341 7..113
AtTrxH05 67 0.00000000000003 232..342 7..114
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 138555262..138555618 357 N° 2 138556280..138556618 339 N° 3 138557467..138557811 345  
join(138555262..138555618,138556280..138556618,138557467..138557811)


exon

Literature and cross-references HaTrx02 (HanXRQChr05g0146641)
DNA ref. HanXRQ genome:   HanXRQChr05 (138555262..138557811)
Protein sequence: HaTrx02 (HanXRQChr05g0146641)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346
PWM (Da):   %s   38572.7  
PI (pH):   %s   6.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLKPQRVVPNDSSLDFNTSSYLLFNPIISSSPTTTAAVPTPPATMAAFTNLILKPTTNIISTTKLHVFTSHYNPKIQSFFPTKSKTHTPPLFVTKASAGAATKTDDNGAAKTKKEEDKVQHIHTVAEFEAALRDAKQKLVVVEFAARNSKQSSEIYPFMVNLSRTCNEVVFLLVLGDESDEMTEFFKREKIEKVPHFNFYKGMEKIHEEEGIGPDRLMGDVLYYGDNHSGVVQLHNREDVEKLIADHKEDNKLIVLDVGLKHCGPCVKVYPTVLKLSKKMETVVFARMNGDENDSCMQFLKDMDVVEVPTFLFIRDGEICGRYVGSGKGELIGEILRYQGVRVTY*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTTGAAACCTCAACGAGTGGTTCCCAATGATTCCTCACTGGATTTCAACACCTCATCCTACCTCCTTTTCAACCCCATCATCTCTTCCTCTCCCACCACCACCGCCGCTGTTCCA
ACTCCTCCGGCCACCATGGCAGCCTTCACAAACCTCATTCTCAAACCAACTACAAACATAATTTCAACAACCAAACTTCATGTTTTCACTTCCCATTACAACCCTAAAATCCAGTCTTTC
TTTCCCACCAAATCCAAAACTCACACACCACCACTTTTTGTGACGAAAGCCTCCGCCGGTGCCGCCACCAAAACCGACGACAACGGAGCTGCCAAAACCAAGAAGGAAGAAGACAAG
GTA
CGACAAGTATTATTAATCAACTATATATAATAACAAAAAAGCTAAAGAAACCTAATCCAACGAAGAGATCGCGTACCAAACAGTACCGCACTATATAGTACTGGTTTTGAAATTTAGCTA
AAACCAAAACCGAATATGGGTATGGGTGTGTGTCTAAATACACCCCTATTTACTTGTTACATAGGAAAAATGATAAGCCCCACACCCAAGTTTGTGAGATAAAGGGGGTGTAACAAGTAA
ATAGGAGGAGTGTATTTATTAGCACTCGATATGGTATATGTTCGGTCGGTACAGATATGGTACAGTATGGTACCATTAAAAGTCTCGTATTGGTACCGTATTGCATTACAATCGATGACA
AAATTTAGCTAAATTCAAAAGTCAAAACCAAGTACCGTGTCGTGTATGTTCGACCGGTACCGGTATAATAAGAGACCATTAAAATTTTCAAACGATACCATAACACATAATACCGATACC
AAAGTTTAGCTAAATCAAAACCGAATACCGTGCCGTATATATCTAGTCGATACCAATACAGTATTGGTACAATACGAGTATTTGGTACAAAATTTCTCATCGAAATAGCATCTTACAAGT
TATAACTAGGGTAATAATATACTAATAAATCGTAACAATATATCCTCTCTAATAACAGGTACAACACATCCACACGGTGGCGGAATTCGAGGCGGCGTTACGCGACGCGAAACAGAAGCT
GGTGGTGGTTGAATTTGCCGCGAGAAACAGCAAACAAAGCAGCGAGATTTACCCCTTCATGGTGAACTTAAGCAGGACATGCAACGAAGTCGTGTTCTTGCTGGTTTTGGGTGATGAATC
CGACGAGATGACGGAGTTTTTCAAAAGAGAAAAGATTGAAAAAGTGCCTCATTTTAACTTCTATAAAGGGATGGAGAAGATCCATGAAGAAGAAGGAATCGGCCCGGATCGCTTGATGGG
TGATGTTTTGTACTACGGTGATAATCACTCCGGCGTT
GTAAGTTTTCCGATCATCTTCTACACTATTTTCTTTAGATTTTAGATAATAAAAGCTTCTGTCGTAATATAGTCACAAATCGG
TAGCTAATTTGTTACGGAAATTTTGGTCGAGAAATTTGGTTGCAAAACGACCGTTGAAACTCGTTGCAAAGGGCATATTGGCGGTAAAAATAGTGGTTTGTTTTTTGGTATAATTTTTAT
AACCATGTATAAAAAAGTTTTGTTAAAGAACTTTTTTTTGTTTAAATACTAGTAATAATTCTTTCAGAGTAAAGTGTGTCTGGTTTATCAAAATTTTAAATTTTGTCCTTAGCTTTCAAA
AAGTACACGAATGTTCCTGTTGTTTACATTTTGTAACACATTTAGTCTCCGACCAATAAATTTAAATGTTTTAGTGTGTCCAAATTAAGGACTAAATGCGTTTACAAAGTGCAAACCACA
TGGACTATCCATATACTTTTGGAAAAAAGTTGGGTATTAAATGCGTTACAAAGTTCAAACCATAGAGACCACTTATATACTTTTAGAAAGCTAGGGACTAAATTAAAAATTTCGGTAAAC
CACATTACTTTTTTTTTAAAAAAACTACTTTTTTTCTACTTTCTTAATTAATAGGCAACATATAACCGATTTTTAAATGAAATTACTTGTCACCCAACAATATCTTCATTAACTACGAGT
AAGATTGTACCGGATAAGATTGTTATTGTTGTAGTTAATTGAAAACATAAAAAACAAAATCTTAATGTCACAAATATGTGTTTTTAGTATTTATATACACTTTTAATAACTTTGTGAAAA
TGTTAAAAGAATTTTGTAATGTAATTTGTATTTTTACACCATTAGGTACAACTACATAACAGAGAAGATGTTGAGAAGCTAATAGCTGATCACAAGGAGGACAATAAACTCATTGTGCTT
GATGTCGGACTCAAACATTGTGGCCCTTGCGTGAAGGTATACCCGACGGTGCTAAAACTATCGAAAAAAATGGAAACGGTGGTTTTTGCAAGGATGAATGGTGACGAGAACGATAGTTGT
ATGCAATTTTTGAAAGATATGGACGTTGTTGAGGTCCCGACCTTTTTGTTCATAAGAGATGGAGAAATCTGCGGGAGGTATGTTGGTTCGGGTAAGGGTGAGCTTATTGGGGAAATTCTT
AGATACCAAGGAGTTCGGGTCACGTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTTGAAACCTCAACGAGTGGTTCCCAATGATTCCTCACTGGATTTCAACACCTCATCCTACCTCCTTTTCAACCCCATCATCTCTTCCTCTCCCACCACCACCGCCGCTGTTCCA
ACTCCTCCGGCCACCATGGCAGCCTTCACAAACCTCATTCTCAAACCAACTACAAACATAATTTCAACAACCAAACTTCATGTTTTCACTTCCCATTACAACCCTAAAATCCAGTCTTTC
TTTCCCACCAAATCCAAAACTCACACACCACCACTTTTTGTGACGAAAGCCTCCGCCGGTGCCGCCACCAAAACCGACGACAACGGAGCTGCCAAAACCAAGAAGGAAGAAGACAAG
GTA
CAACACATCCACACGGTGGCGGAATTCGAGGCGGCGTTACGCGACGCGAAACAGAAGCTGGTGGTGGTTGAATTTGCCGCGAGAAACAGCAAACAAAGCAGCGAGATTTACCCCTTCATG
GTGAACTTAAGCAGGACATGCAACGAAGTCGTGTTCTTGCTGGTTTTGGGTGATGAATCCGACGAGATGACGGAGTTTTTCAAAAGAGAAAAGATTGAAAAAGTGCCTCATTTTAACTTC
TATAAAGGGATGGAGAAGATCCATGAAGAAGAAGGAATCGGCCCGGATCGCTTGATGGGTGATGTTTTGTACTACGGTGATAATCACTCCGGCGTT
GTACAACTACATAACAGAGAAGAT
GTTGAGAAGCTAATAGCTGATCACAAGGAGGACAATAAACTCATTGTGCTTGATGTCGGACTCAAACATTGTGGCCCTTGCGTGAAGGTATACCCGACGGTGCTAAAACTATCGAAAAAA
ATGGAAACGGTGGTTTTTGCAAGGATGAATGGTGACGAGAACGATAGTTGTATGCAATTTTTGAAAGATATGGACGTTGTTGAGGTCCCGACCTTTTTGTTCATAAGAGATGGAGAAATC
TGCGGGAGGTATGTTGGTTCGGGTAAGGGTGAGCTTATTGGGGAAATTCTTAGATACCAAGGAGTTCGGGTCACGTATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAATAAATTT GGATAAAACC AAATATTGTT AATAAAATAT CCAGTTCAAA AAAATCAAAG TGAATGGTGG ACATTGGTGG ATGAGCTTGA AACCTCAACG AGTGGTTCCC AATGATTCCT  CACTGGATTT CAACACCTCA TCCTACCTCC TTTTCAACCC CATCATCTCT TCCTCTCCCA CCACCACCGC CGCTGTTCCA ACTCCTCCGG CCACCATGGC AGCCTTCACA AACCTCATTC  TCAAACCAAC TACAAACATA ATTTCAACAA CCAAACTTCA TGTTTTCACT TCCCATTACA ACCCTAAAAT CCAGTCTTTC TTTCCCACCA AATCCAAAAC TCACACACCA CCACTTTTTG  TGACGAAAGC CTCCGCCGGT GCCGCCACCA AAACCGACGA CAACGGAGCT GCCAAAACCA AGAAGGAAGA AGACAAGGTA CAACACATCC ACACGGTGGC GGAATTCGAG GCGGCGTTAC  GCGACGCGAA ACAGAAGCTG GTGGTGGTTG AATTTGCCGC GAGAAACAGC AAACAAAGCA GCGAGATTTA CCCCTTCATG GTGAACTTAA GCAGGACATG CAACGAAGTC GTGTTCTTGC  TGGTTTTGGG TGATGAATCC GACGAGATGA CGGAGTTTTT CAAAAGAGAA AAGATTGAAA AAGTGCCTCA TTTTAACTTC TATAAAGGGA TGGAGAAGAT CCATGAAGAA GAAGGAATCG  GCCCGGATCG CTTGATGGGT GATGTTTTGT ACTACGGTGA TAATCACTCC GGCGTTGTAC AACTACATAA CAGAGAAGAT GTTGAGAAGC TAATAGCTGA TCACAAGGAG GACAATAAAC  TCATTGTGCT TGATGTCGGA CTCAAACATT GTGGCCCTTG CGTGAAGGTA TACCCGACGG TGCTAAAACT ATCGAAAAAA ATGGAAACGG TGGTTTTTGC AAGGATGAAT GGTGACGAGA  ACGATAGTTG TATGCAATTT TTGAAAGATA TGGACGTTGT TGAGGTCCCG ACCTTTTTGT TCATAAGAGA TGGAGAAATC TGCGGGAGGT ATGTTGGTTC GGGTAAGGGT GAGCTTATTG  GGGAAATTCT TAGATACCAA GGAGTTCGGG TCACGTATTA ACTAGTTCGG TAGATTAAAA GGAATTGAGT ACACATGTTT TAGTAAAAAA ATGTATTGTG TAACATTTAA GTTGCTATGT  ATTTTTGAAC TTTATGGACC GTGCTTATGC ATTCATCTAG GACCATTTAT AAGATAAAGA AACCAAACAT AAGTAGAGAA CTAAAGTTAC CGCATAAATG TCATCATACA CAAGTTATGA  AAACGAAGAG AGAGAAACAA AAAAAAAAAA AAAAACCCGC ATATATTCTA ACTATGGTGA ACAACAAGTG ACACTAAGCA CCCTAAGACC ACTAGGTTTT ATGGCGTGGA GACACCCCTA 
CACCACCCCG CCACCACTGT TGGAGAGCGT TCCCCC 

Retrieve as FASTA